SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_3800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_3800
Domain Number 1 Region: 62-169
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.13e-19
Family Heme-binding PAS domain 0.032
Further Details:      
 
Domain Number 2 Region: 159-278
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.55e-19
Family Heme-binding PAS domain 0.017
Further Details:      
 
Domain Number 3 Region: 305-405
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.82e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 
Weak hits

Sequence:  357808.RoseRS_3800
Domain Number - Region: 4-31
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00497
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_3800
Sequence length 430
Comment (Roseiflexus RS-1)
Sequence
MSSETITRLEAENAALRQRINELEMRLEAYHTGNAMLRTTGHTGAFNEFQGFRTTVERAS
QGIVIVHLEGVITYVNSAFCALTGYHALVGRHISTLYFEYDLPLLDRGLQKVRYDGIWQD
NISLRRSDGAAIPVHIDAFLICDDAGQPAAITVIVEDLTEELRREERLRLFEALVENAPD
AIGVANVRGNVIYANTAYQTLTGCGDQLIGMNAFDGIVEHDRQAVRTALARLEDNNAVVL
DIRIQRRDGGIAPVSAAMYAQRSPRDEVWLIGFLRDISDQKRAEAERFALQQQVIEAQRA
AIRELSTPLIPISETAVIMPLVGAIDSARAQQIIDTLLEGVAAHRADVAIVDITGVQVVD
TQVASALVRAAQAVRLLGAQVILTGIKPQVAQTLVQLGVSLEGIRTTGSLQTGIRLALDH
DAIRRKGAGR
Download sequence
Identical sequences A5UZV1
gi|148657899|ref|YP_001278104.1| 357808.RoseRS_3800 WP_011958496.1.23570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]