SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357808.RoseRS_4158 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357808.RoseRS_4158
Domain Number 1 Region: 414-516
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-16
Family Anti-sigma factor antagonist SpoIIaa 0.004
Further Details:      
 
Domain Number 2 Region: 316-365
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000405
Family HAMP domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357808.RoseRS_4158
Sequence length 556
Comment (Roseiflexus RS-1)
Sequence
MNITSASRHSSRSLSLLLALALISLSVLSLSISNALQVASNWRVHQRALAAQQQSLAHGV
AVETQTFLDARWNMLNTAIRMSNLATAPVAHRIEALQRLLALDPSFEQLTILDDRRFVVA
AVSQNRQRTPNFLDTALVEEIMHQTTLRNRYVSSLRIDGATGEPGIILALPLVDSFENDQ
GALIATVNARFLWDALKRQLPFREGIAYIVNRDGDLLACTDTARVLRGDTAVDIPVVQAA
FAHDRSGSFQTLHYTGLTGIEVVGSYEALREPAWAVVVEVPRTVAYRDIVNDIGVSALIL
LSAAVVSGGIGVYLARWLSAPLHRLTRLAERIAAGERDLRVAVRGPREVEILARAFDTMT
TQLEQNLETLEHRVAERTADLQAALARVEAQAQEQARLLEEIAQQRQAIRELSVPVLPVT
DQALVMPLVGAIDTERLADIQDRALHALQRSHARYLLVDITGVPVVDSQVAQGLLAINAM
CRLLGAEMVLIGIRPEVAQTIVGLGMNLSSLRTAADLQTILGEITRRDQGRATRNGAANG
GIAQNHAFFDLFSSRD
Download sequence
Identical sequences A5V0U9
WP_011958839.1.23570 357808.RoseRS_4158 gi|148658247|ref|YP_001278452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]