SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 357809.Cphy_1609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357809.Cphy_1609
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.63e-26
Family DNA-binding N-terminal domain of transcription activators 0.0011
Further Details:      
 
Domain Number 2 Region: 145-269
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.88e-21
Family Multidrug-binding domain of transcription activator BmrR 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357809.Cphy_1609
Sequence length 272
Comment (Clostridium phytofermentans ISDg)
Sequence
MNTKFTVGEIAKLSGLSKQTLIYYDKENVFKPKLVDSNNNYRYYTADQIEVLDSILILKE
IGLSLKEIKDFMNHRNSDNAVALLKNQQKEIKQKIKQLSLIENRLDYKLRTLQEFDRDSE
RVQITTLEKTEYLAIEPVTTPNGLLDVDLAIKRLLTKANNHNYPYYYQIGDMVSKENLLL
GNYISFEYAFLPLQVAPEKGTYHKKVKGTYAKCYHQGPYKNITDTYQFLIEYIKKEGYQI
ASPSYEYCILDSLTTKKSEEYVTEIQIKIEKT
Download sequence
Identical sequences A9KQS0
gi|160879754|ref|YP_001558722.1| WP_012199637.1.8979 357809.Cphy_1609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]