SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357809.Cphy_2940 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357809.Cphy_2940
Domain Number 1 Region: 76-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000222
Family NfeD domain-like 0.0067
Further Details:      
 
Weak hits

Sequence:  357809.Cphy_2940
Domain Number - Region: 14-74
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000484
Family LacY-like proton/sugar symporter 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357809.Cphy_2940
Sequence length 146
Comment (Clostridium phytofermentans ISDg)
Sequence
MVSLCWLIVLALLLAIEIATLGLTTVWFAGGALIGFIASLLGVDFWIQMILFILVSLLLL
FFTRPVAVKHLNKSRVKTNYEGLIGKVVKITQQVDNDNQTGEALVNGQEWTVRSETDGVI
YEPGTKVRIVNIVGVKLIVTEYREEN
Download sequence
Identical sequences A9KPM3
gi|160881068|ref|YP_001560036.1| 357809.Cphy_2940 WP_012200948.1.8979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]