SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357809.Cphy_3087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357809.Cphy_3087
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.12e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357809.Cphy_3087
Sequence length 191
Comment (Clostridium phytofermentans ISDg)
Sequence
METKNIMIVGVGGQGTLLTSRILGGITRIAGYDVKLSEVHGMAQRGGSVVTFVRYGEKVY
EPIVEEGQADVLIAFERLEAMRYSHFLKKSGVLIVNDQRIDPMPVVIGASIYPENIIENL
EKEHRVLRVDAMAKAKELGNPKVFNIIVLGVAAAYMDFTKDDWLTVIEQTVPPKTIDINI
EAFLIGYEMHQ
Download sequence
Identical sequences A9KQW4
gi|160881214|ref|YP_001560182.1| WP_012201094.1.8979 357809.Cphy_3087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]