SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357809.Cphy_3123 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357809.Cphy_3123
Domain Number 1 Region: 179-434
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.34e-65
Family PFOR Pyr module 0.056
Further Details:      
 
Domain Number 2 Region: 1-203
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0094
Further Details:      
 
Domain Number 3 Region: 444-551
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000209
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 357809.Cphy_3123
Sequence length 556
Comment (Clostridium phytofermentans ISDg)
Sequence
MYNILVGGAAGQGIDTTVANLEVLLKKAGYYVFTIKDFMSRVRGGHNFSLIRFGNEIITS
HSNELDGMIALDDDTVELHKQNLKQDGFILCDTKLTTTDPKAIKLNMGGMAKELGNVRVS
GSIAIGVILKLFGIATDHVEETMKNLVKEAYLDMNVKAVRLGYESVETRFSITPGNFSDW
MIISGSKSLALGAIAAGIKFYSAYPMSPSTAIMEYLASKSVEADFVVEQAEDEIAAINMA
IGASYAGARAMTGTSGGGFCLKVEALGLSGIAEIPLVAVNVQRPGPATGLPTRTEQSDLK
FVISAAQGEFPRMVIALRNHKDAFYQTIRAFDITEKYQIPVIILSDQYLGDSTATVEPFD
ISNIKIANPSNDEYKEGEYLRYQLTENGISPRLIPGKSRNFVSVDSDEHDERGFITESAD
VRNQMMDKRMKKLELLREELLEPEFFGEENCETLFLGWGSTYGPIAEAVSILNEDEPGKY
GALSFGDVYPLPTKLLMEKASKAKQIVNIEQNATGQLKDLIREQTGILCTGSILKYDGRQ
ISGEEIVEKIRKGGQK
Download sequence
Identical sequences A9KR00
WP_012201130.1.8979 gi|160881250|ref|YP_001560218.1| 357809.Cphy_3123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]