SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357809.Cphy_3558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357809.Cphy_3558
Domain Number 1 Region: 796-1174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.69e-126
Family PFOR PP module 0.0000000029
Further Details:      
 
Domain Number 2 Region: 413-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000986
Further Details:      
 
Domain Number 3 Region: 3-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.41e-77
Family PFOR Pyr module 0.0000000206
Further Details:      
 
Domain Number 4 Region: 259-407
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.42e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000102
Further Details:      
 
Domain Number 5 Region: 669-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.09e-17
Family Ferredoxin domains from multidomain proteins 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 357809.Cphy_3558
Sequence length 1175
Comment (Clostridium phytofermentans ISDg)
Sequence
MARKMKTMDGNTAAAHVSYAFTDVAAIYPITPSSPMADYTDMWATQGRKNIFGHEVLLSE
MQSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNMYKIAGELLPGVINVSARALASHA
LSIFGDHSDVYACRQSGFAMLCSGNVQETMDLGAVAHLTAIDGRVPFIHFFDGFRTSHEI
QKISIWDYEDLKEMTNMEAVDAFRNRALNPEHPVQRGTAQNPDVFFQAREACNQYYDAIP
ELTQVYMDKVNAKIGTDYKLFNYYGAADAEHVVIAMGSVCDTIEETIDHMNASGAKVGLI
KVRLYRPFSAKHLLETIPASVKQITVLDRTKEPGALGEPLYLDVVAALKDTQFHNLPVLT
GRYGLGSKDTTPAQIIAVYNNKDKKNFTIGINDDVTHLSLDITENPDTANKGTTACKFWG
LGADGTVGANKNSIKIIGDHTDKYAQAYFDYDSKKSGGVTISHLRFGDSPIKSTYLINKA
DFVACHMPAYVRRYNMVQDLKKGGTFLLNCSWNMEEIEKNLPGQVKRYMAQNNIKFYTID
GIQIGKEVGLGGRINTILQAAFFKLANIIPIEDAVKYMKDAATASYSKKGDDIVKMNHTA
IDRGVDGLVEIKVPAEWANASDEDLAAKATVGRPEVLDYVNTILHKVNAQDGNSLPVSAF
VDNADGTVPLGTAAYEKRGIAIDVPVWNPEICLQCNLCSYVCPHAVIRPVVMNEEQAANA
PEGMKMVTMKQVEGKKFAITISVLDCTGCGSCAHVCPEVKGNKALSMDLLENHYDDQKYA
DYAASLETPVEILEKFKETTVKGSQFKQPLLEFSGACAGCGETPYAKLVTQLYGDRMYIA
NATGCSSIWGGSSPSTPYTVNKEGKGPAWANSLFEDNAEFGFGMQLAQTALRKRLIDSTE
NLVANSSSADVKAAAEEFLATQNNSTANAPATKNLLAALEACGCDNADRENILKNKSFLA
KKSQWIFGGDGWAYDIGFGGLDHVIASGQDVNIMVFDTEVYSNTGGQSSKATPTGAIAQF
AAAGKEVKKKDLAQIAMSYGYVYVAQIAQGADYNQCIKAITEAENYPGPSLIIAYAPCIN
HGIKGGMTGAQTEEKRAVEAGYWHLFRFNPTLKEEGKNPFVLDSKAPKASYQEFLQSEVR
YNRLSRTNPERAAELFAKAEKDAKEKYEKLVKMAE
Download sequence
Identical sequences A9KIP4
gi|160881678|ref|YP_001560646.1| WP_012201555.1.8979 357809.Cphy_3558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]