SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_05030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_05030
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.65e-22
Family Anti-sigma factor antagonist SpoIIaa 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_05030
Sequence length 108
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MDLLIQTTSLETEHRVVLGGDIDAFTAPKVKETLMSLVTKPDINHITVDLEAVEYMDSTG
IGIFIGIMKECFQRNRTFEVHKMSPRVERLFRITGLYDHIAIRKGESE
Download sequence
Identical sequences A0A0K9MFF8 A0A1Y4X185 C0ZK29
gi|226310090|ref|YP_002769984.1| 358681.BBR47_05030 WP_012684246.1.1548 WP_012684246.1.45054 WP_012684246.1.4786 WP_012684246.1.78400 WP_012684246.1.99580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]