SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_18070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_18070
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.36e-18
Family Rob transcription factor, C-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_18070
Sequence length 158
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MEGTIVHVPQKYLVGLSFSGSFPMLVEYMPKLWETFLTRQDEIPLAISPDVRYDISDENR
THQMYTEYIVVEVERFEHIPEGMVGFTIPTKTYARFTHTGPMEQVQNTYHSLFGWLNENG
HQVDEQALRMERYDQRYVPSVHESARVDNAYEIFIPLR
Download sequence
Identical sequences C0ZAH5
358681.BBR47_18070 WP_012685527.1.45054 gi|226311394|ref|YP_002771288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]