SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_20560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_20560
Domain Number 1 Region: 37-209
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.32e-26
Family Clp protease, ClpP subunit 0.014
Further Details:      
 
Domain Number 2 Region: 385-443
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000301
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_20560
Sequence length 447
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MSATRLVKSRVRLLFSLLCLIMGMTMLFAPASTTAKTYQKAVWIPVDSTIERGLESFLHR
AFADAQQQQADLVILHINTPGGEVNAADQIGQLIRQAPMHVIAYIDNQAFSAGTYIALNA
NEIIMTPGSSMGAATPIDLAGNAADIKFISGWSNKMKAAAELNNRNPDVARAMVEIDTEF
PGLKPKGTVLSLDAQQAKRLGYADDVVSNKEELLKKLGIQPDSLQAIEPTGGELVARWVT
SPIVMSLLLIIGLGGIVVELFAPGFGVAGTISLFAFSLYFFGHYVAGFANWLHIGLFVVG
ILLMLLEIFLPGGIVGAIGFLSIVTGLVMAAYDTKQGLASLGVAALVTVIVAFMLVKKYG
VKGLFNKFVLGETQSSEEGYVAPRDQRELEGKSGIALTPLRPAGVVKVEGKRVDAVSVGG
FIEAGTAITVVQVEGTRIVVAELEQKE
Download sequence
Identical sequences C0ZB74
gi|226311643|ref|YP_002771537.1| 358681.BBR47_20560 WP_012685764.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]