SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 359786.SaurJH9_1846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  359786.SaurJH9_1846
Domain Number 1 Region: 136-320
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-28
Family D-glucarate dehydratase-like 0.00099
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.48e-19
Family Enolase N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 359786.SaurJH9_1846
Sequence length 333
Comment (Staphylococcus aureus JH9)
Sequence
MKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHET
IASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVA
YGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQD
FTQLQLLAREQVLYIEEPFKDISMLDEVVDGTIPPIALDEKATSLLDIINLIELYNVKVV
VLKPFRLGGIDKVQTAIDTLKSHGVKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGY
YFDQDVVTKSGILKEGRLEFRPPLVDITQLQPY
Download sequence
Identical sequences A0A0H3JN27 A0A0H3JSW4 A0A1Q8R4F3
gi|156980112|ref|YP_001442371.1| gi|148268267|ref|YP_001247210.1| gi|387150936|ref|YP_005742500.1| NYSGXRC-9307b gi|15924786|ref|NP_372320.1| WP_000778528.1.10014 WP_000778528.1.100171 WP_000778528.1.100184 WP_000778528.1.100235 WP_000778528.1.10032 WP_000778528.1.100366 WP_000778528.1.100399 WP_000778528.1.10046 WP_000778528.1.100464 WP_000778528.1.10050 WP_000778528.1.100535 WP_000778528.1.100562 WP_000778528.1.100582 WP_000778528.1.100596 WP_000778528.1.100693 WP_000778528.1.100699 WP_000778528.1.100704 WP_000778528.1.100719 WP_000778528.1.100823 WP_000778528.1.100860 WP_000778528.1.100888 WP_000778528.1.100934 WP_000778528.1.10097 WP_000778528.1.101002 WP_000778528.1.101019 WP_000778528.1.101027 WP_000778528.1.101068 WP_000778528.1.101071 WP_000778528.1.101072 WP_000778528.1.101103 WP_000778528.1.10111 WP_000778528.1.101160 WP_000778528.1.101192 WP_000778528.1.101262 WP_000778528.1.101379 WP_000778528.1.101414 WP_000778528.1.101440 WP_000778528.1.101441 WP_000778528.1.10148 WP_000778528.1.101567 WP_000778528.1.10165 WP_000778528.1.101661 WP_000778528.1.101691 WP_000778528.1.101704 WP_000778528.1.101728 WP_000778528.1.101745 WP_000778528.1.101778 WP_000778528.1.101813 WP_000778528.1.101820 WP_000778528.1.101825 WP_000778528.1.101852 WP_000778528.1.101902 WP_000778528.1.101906 WP_000778528.1.101943 WP_000778528.1.102096 WP_000778528.1.102123 WP_000778528.1.102130 WP_000778528.1.102132 WP_000778528.1.10238 WP_000778528.1.1025 WP_000778528.1.10274 WP_000778528.1.1031 WP_000778528.1.10343 WP_000778528.1.1043 WP_000778528.1.10436 WP_000778528.1.10478 WP_000778528.1.10481 WP_000778528.1.10526 WP_000778528.1.10624 WP_000778528.1.10749 WP_000778528.1.10751 WP_000778528.1.1077 WP_000778528.1.10823 WP_000778528.1.10858 WP_000778528.1.10919 WP_000778528.1.10942 WP_000778528.1.10976 WP_000778528.1.10979 WP_000778528.1.11069 WP_000778528.1.11073 WP_000778528.1.11083 WP_000778528.1.1115 WP_000778528.1.11162 WP_000778528.1.11220 WP_000778528.1.11261 WP_000778528.1.11286 WP_000778528.1.11322 WP_000778528.1.11333 WP_000778528.1.11378 WP_000778528.1.11403 WP_000778528.1.11447 WP_000778528.1.11451 WP_000778528.1.1147 WP_000778528.1.11504 WP_000778528.1.11513 WP_000778528.1.11556 WP_000778528.1.11611 WP_000778528.1.11640 WP_000778528.1.11646 WP_000778528.1.11663 WP_000778528.1.1171 WP_000778528.1.11730 WP_000778528.1.11736 WP_000778528.1.11768 WP_000778528.1.11794 WP_000778528.1.11837 WP_000778528.1.11884 WP_000778528.1.11903 WP_000778528.1.12019 WP_000778528.1.1210 WP_000778528.1.12152 WP_000778528.1.12170 WP_000778528.1.12175 WP_000778528.1.12234 WP_000778528.1.12256 WP_000778528.1.12437 WP_000778528.1.1257 WP_000778528.1.12598 WP_000778528.1.12608 WP_000778528.1.12618 WP_000778528.1.12685 WP_000778528.1.12733 WP_000778528.1.12737 WP_000778528.1.12770 WP_000778528.1.12780 WP_000778528.1.12788 WP_000778528.1.12829 WP_000778528.1.12858 WP_000778528.1.12884 WP_000778528.1.12904 WP_000778528.1.12918 WP_000778528.1.12920 WP_000778528.1.13013 WP_000778528.1.13062 WP_000778528.1.13243 WP_000778528.1.13250 WP_000778528.1.13326 WP_000778528.1.13355 WP_000778528.1.13379 WP_000778528.1.13405 WP_000778528.1.13448 WP_000778528.1.13514 WP_000778528.1.13612 WP_000778528.1.13665 WP_000778528.1.13668 WP_000778528.1.13670 WP_000778528.1.13879 WP_000778528.1.13897 WP_000778528.1.13933 WP_000778528.1.14025 WP_000778528.1.14097 WP_000778528.1.14143 WP_000778528.1.14163 WP_000778528.1.1420 WP_000778528.1.14201 WP_000778528.1.1425 WP_000778528.1.1429 WP_000778528.1.14305 WP_000778528.1.14342 WP_000778528.1.14358 WP_000778528.1.14397 WP_000778528.1.14412 WP_000778528.1.14535 WP_000778528.1.14596 WP_000778528.1.14639 WP_000778528.1.14696 WP_000778528.1.1471 WP_000778528.1.14729 WP_000778528.1.14734 WP_000778528.1.14774 WP_000778528.1.14825 WP_000778528.1.14846 WP_000778528.1.14967 WP_000778528.1.14970 WP_000778528.1.15015 WP_000778528.1.15029 WP_000778528.1.15108 WP_000778528.1.15173 WP_000778528.1.15185 WP_000778528.1.1520 WP_000778528.1.15201 WP_000778528.1.1525 WP_000778528.1.15268 WP_000778528.1.15269 WP_000778528.1.15294 WP_000778528.1.15296 WP_000778528.1.15421 WP_000778528.1.15533 WP_000778528.1.15544 WP_000778528.1.15546 WP_000778528.1.1558 WP_000778528.1.15590 WP_000778528.1.1564 WP_000778528.1.15691 WP_000778528.1.15785 WP_000778528.1.15812 WP_000778528.1.15920 WP_000778528.1.15921 WP_000778528.1.15925 WP_000778528.1.16018 WP_000778528.1.16068 WP_000778528.1.16096 WP_000778528.1.16098 WP_000778528.1.16140 WP_000778528.1.16173 WP_000778528.1.16195 WP_000778528.1.16203 WP_000778528.1.16223 WP_000778528.1.1623 WP_000778528.1.16251 WP_000778528.1.16276 WP_000778528.1.16311 WP_000778528.1.16395 WP_000778528.1.16407 WP_000778528.1.16458 WP_000778528.1.16589 WP_000778528.1.16632 WP_000778528.1.16639 WP_000778528.1.1665 WP_000778528.1.16651 WP_000778528.1.16653 WP_000778528.1.16693 WP_000778528.1.16747 WP_000778528.1.16761 WP_000778528.1.16794 WP_000778528.1.16824 WP_000778528.1.16880 WP_000778528.1.16920 WP_000778528.1.16925 WP_000778528.1.16969 WP_000778528.1.17046 WP_000778528.1.17080 WP_000778528.1.17122 WP_000778528.1.17132 WP_000778528.1.17139 WP_000778528.1.17157 WP_000778528.1.17180 WP_000778528.1.17240 WP_000778528.1.17309 WP_000778528.1.17327 WP_000778528.1.1736 WP_000778528.1.1741 WP_000778528.1.17419 WP_000778528.1.17454 WP_000778528.1.17529 WP_000778528.1.17531 WP_000778528.1.1756 WP_000778528.1.17590 WP_000778528.1.17643 WP_000778528.1.1765 WP_000778528.1.17671 WP_000778528.1.17717 WP_000778528.1.17718 WP_000778528.1.17725 WP_000778528.1.17737 WP_000778528.1.17818 WP_000778528.1.17832 WP_000778528.1.17847 WP_000778528.1.17853 WP_000778528.1.17909 WP_000778528.1.17943 WP_000778528.1.17987 WP_000778528.1.18011 WP_000778528.1.18069 WP_000778528.1.18080 WP_000778528.1.18113 WP_000778528.1.18140 WP_000778528.1.18153 WP_000778528.1.18203 WP_000778528.1.18237 WP_000778528.1.18248 WP_000778528.1.18261 WP_000778528.1.18288 WP_000778528.1.1829 WP_000778528.1.18301 WP_000778528.1.18309 WP_000778528.1.18310 WP_000778528.1.18360 WP_000778528.1.18412 WP_000778528.1.18429 WP_000778528.1.1847 WP_000778528.1.18487 WP_000778528.1.18506 WP_000778528.1.18507 WP_000778528.1.18539 WP_000778528.1.18560 WP_000778528.1.18570 WP_000778528.1.18591 WP_000778528.1.18632 WP_000778528.1.18679 WP_000778528.1.18741 WP_000778528.1.18792 WP_000778528.1.18818 WP_000778528.1.18819 WP_000778528.1.18834 WP_000778528.1.18882 WP_000778528.1.1892 WP_000778528.1.18974 WP_000778528.1.18996 WP_000778528.1.19052 WP_000778528.1.19082 WP_000778528.1.1911 WP_000778528.1.19301 WP_000778528.1.19322 WP_000778528.1.19430 WP_000778528.1.19450 WP_000778528.1.19537 WP_000778528.1.19555 WP_000778528.1.19577 WP_000778528.1.19611 WP_000778528.1.1964 WP_000778528.1.19643 WP_000778528.1.19701 WP_000778528.1.19725 WP_000778528.1.19732 WP_000778528.1.1974 WP_000778528.1.19748 WP_000778528.1.19792 WP_000778528.1.19816 WP_000778528.1.19848 WP_000778528.1.19891 WP_000778528.1.19912 WP_000778528.1.19980 WP_000778528.1.19981 WP_000778528.1.19982 WP_000778528.1.20006 WP_000778528.1.20049 WP_000778528.1.20052 WP_000778528.1.2007 WP_000778528.1.20078 WP_000778528.1.2008 WP_000778528.1.20090 WP_000778528.1.20100 WP_000778528.1.20156 WP_000778528.1.20161 WP_000778528.1.20167 WP_000778528.1.20191 WP_000778528.1.20214 WP_000778528.1.20245 WP_000778528.1.2029 WP_000778528.1.20324 WP_000778528.1.20340 WP_000778528.1.20394 WP_000778528.1.20398 WP_000778528.1.20399 WP_000778528.1.20411 WP_000778528.1.20447 WP_000778528.1.20479 WP_000778528.1.20487 WP_000778528.1.20574 WP_000778528.1.20579 WP_000778528.1.20585 WP_000778528.1.20611 WP_000778528.1.20619 WP_000778528.1.20620 WP_000778528.1.20736 WP_000778528.1.20796 WP_000778528.1.20821 WP_000778528.1.20846 WP_000778528.1.20867 WP_000778528.1.20878 WP_000778528.1.20913 WP_000778528.1.20922 WP_000778528.1.20939 WP_000778528.1.20945 WP_000778528.1.20971 WP_000778528.1.21056 WP_000778528.1.21066 WP_000778528.1.21078 WP_000778528.1.21109 WP_000778528.1.21111 WP_000778528.1.21154 WP_000778528.1.21183 WP_000778528.1.2119 WP_000778528.1.21257 WP_000778528.1.21272 WP_000778528.1.21313 WP_000778528.1.21339 WP_000778528.1.2135 WP_000778528.1.21359 WP_000778528.1.21375 WP_000778528.1.21379 WP_000778528.1.21393 WP_000778528.1.21412 WP_000778528.1.21464 WP_000778528.1.21480 WP_000778528.1.21500 WP_000778528.1.21514 WP_000778528.1.21572 WP_000778528.1.2159 WP_000778528.1.2160 WP_000778528.1.21636 WP_000778528.1.21724 WP_000778528.1.21746 WP_000778528.1.21763 WP_000778528.1.21787 WP_000778528.1.21830 WP_000778528.1.21988 WP_000778528.1.22027 WP_000778528.1.22082 WP_000778528.1.22111 WP_000778528.1.22177 WP_000778528.1.22197 WP_000778528.1.22227 WP_000778528.1.22302 WP_000778528.1.22400 WP_000778528.1.22493 WP_000778528.1.22533 WP_000778528.1.22559 WP_000778528.1.22650 WP_000778528.1.22696 WP_000778528.1.22702 WP_000778528.1.22709 WP_000778528.1.22738 WP_000778528.1.22789 WP_000778528.1.22790 WP_000778528.1.22792 WP_000778528.1.22803 WP_000778528.1.22853 WP_000778528.1.22869 WP_000778528.1.22890 WP_000778528.1.23008 WP_000778528.1.23061 WP_000778528.1.23082 WP_000778528.1.23103 WP_000778528.1.23130 WP_000778528.1.23132 WP_000778528.1.23133 WP_000778528.1.23185 WP_000778528.1.23244 WP_000778528.1.2327 WP_000778528.1.23275 WP_000778528.1.23288 WP_000778528.1.23449 WP_000778528.1.23531 WP_000778528.1.23644 WP_000778528.1.23690 WP_000778528.1.23740 WP_000778528.1.23796 WP_000778528.1.23809 WP_000778528.1.23842 WP_000778528.1.2389 WP_000778528.1.23900 WP_000778528.1.23956 WP_000778528.1.23972 WP_000778528.1.23995 WP_000778528.1.24000 WP_000778528.1.24129 WP_000778528.1.24174 WP_000778528.1.24207 WP_000778528.1.24213 WP_000778528.1.24263 WP_000778528.1.2427 WP_000778528.1.24277 WP_000778528.1.24343 WP_000778528.1.24416 WP_000778528.1.24437 WP_000778528.1.24469 WP_000778528.1.2450 WP_000778528.1.24589 WP_000778528.1.24602 WP_000778528.1.24679 WP_000778528.1.24823 WP_000778528.1.24855 WP_000778528.1.2497 WP_000778528.1.2501 WP_000778528.1.25012 WP_000778528.1.2506 WP_000778528.1.25070 WP_000778528.1.25092 WP_000778528.1.25098 WP_000778528.1.25115 WP_000778528.1.25145 WP_000778528.1.25167 WP_000778528.1.25209 WP_000778528.1.25287 WP_000778528.1.25361 WP_000778528.1.25459 WP_000778528.1.25489 WP_000778528.1.2552 WP_000778528.1.25557 WP_000778528.1.25595 WP_000778528.1.25621 WP_000778528.1.25623 WP_000778528.1.25721 WP_000778528.1.25758 WP_000778528.1.25772 WP_000778528.1.25779 WP_000778528.1.25802 WP_000778528.1.25840 WP_000778528.1.25856 WP_000778528.1.25857 WP_000778528.1.2590 WP_000778528.1.25910 WP_000778528.1.25930 WP_000778528.1.26039 WP_000778528.1.26086 WP_000778528.1.26106 WP_000778528.1.26143 WP_000778528.1.26169 WP_000778528.1.2621 WP_000778528.1.26255 WP_000778528.1.26276 WP_000778528.1.26290 WP_000778528.1.26298 WP_000778528.1.26314 WP_000778528.1.26318 WP_000778528.1.26340 WP_000778528.1.26345 WP_000778528.1.26354 WP_000778528.1.26359 WP_000778528.1.26364 WP_000778528.1.26399 WP_000778528.1.26404 WP_000778528.1.2643 WP_000778528.1.26506 WP_000778528.1.26662 WP_000778528.1.26677 WP_000778528.1.26692 WP_000778528.1.2673 WP_000778528.1.26751 WP_000778528.1.26772 WP_000778528.1.26804 WP_000778528.1.2684 WP_000778528.1.26840 WP_000778528.1.26865 WP_000778528.1.26884 WP_000778528.1.2689 WP_000778528.1.26903 WP_000778528.1.26905 WP_000778528.1.26938 WP_000778528.1.26944 WP_000778528.1.27013 WP_000778528.1.27053 WP_000778528.1.27083 WP_000778528.1.27166 WP_000778528.1.27170 WP_000778528.1.27182 WP_000778528.1.2719 WP_000778528.1.27262 WP_000778528.1.27293 WP_000778528.1.27323 WP_000778528.1.27379 WP_000778528.1.27387 WP_000778528.1.27447 WP_000778528.1.27456 WP_000778528.1.27468 WP_000778528.1.2753 WP_000778528.1.27539 WP_000778528.1.27628 WP_000778528.1.27646 WP_000778528.1.27689 WP_000778528.1.27739 WP_000778528.1.27744 WP_000778528.1.27765 WP_000778528.1.27793 WP_000778528.1.27830 WP_000778528.1.2795 WP_000778528.1.28016 WP_000778528.1.28091 WP_000778528.1.28105 WP_000778528.1.28173 WP_000778528.1.28213 WP_000778528.1.28226 WP_000778528.1.28230 WP_000778528.1.28253 WP_000778528.1.28274 WP_000778528.1.28315 WP_000778528.1.28319 WP_000778528.1.28347 WP_000778528.1.28400 WP_000778528.1.28430 WP_000778528.1.2852 WP_000778528.1.28578 WP_000778528.1.28580 WP_000778528.1.28605 WP_000778528.1.28652 WP_000778528.1.28720 WP_000778528.1.28763 WP_000778528.1.28784 WP_000778528.1.28785 WP_000778528.1.28848 WP_000778528.1.28871 WP_000778528.1.28909 WP_000778528.1.28981 WP_000778528.1.29060 WP_000778528.1.29112 WP_000778528.1.29155 WP_000778528.1.29166 WP_000778528.1.29187 WP_000778528.1.29226 WP_000778528.1.29242 WP_000778528.1.29263 WP_000778528.1.29276 WP_000778528.1.29366 WP_000778528.1.29395 WP_000778528.1.29420 WP_000778528.1.29468 WP_000778528.1.29522 WP_000778528.1.2957 WP_000778528.1.2972 WP_000778528.1.29736 WP_000778528.1.29744 WP_000778528.1.29788 WP_000778528.1.2981 WP_000778528.1.29862 WP_000778528.1.29902 WP_000778528.1.29905 WP_000778528.1.29918 WP_000778528.1.29981 WP_000778528.1.30051 WP_000778528.1.30095 WP_000778528.1.30100 WP_000778528.1.30152 WP_000778528.1.30197 WP_000778528.1.30204 WP_000778528.1.30209 WP_000778528.1.30249 WP_000778528.1.30268 WP_000778528.1.30302 WP_000778528.1.30307 WP_000778528.1.30328 WP_000778528.1.30364 WP_000778528.1.30508 WP_000778528.1.30531 WP_000778528.1.30560 WP_000778528.1.30622 WP_000778528.1.30645 WP_000778528.1.30646 WP_000778528.1.30666 WP_000778528.1.30702 WP_000778528.1.30720 WP_000778528.1.30726 WP_000778528.1.30763 WP_000778528.1.3077 WP_000778528.1.31005 WP_000778528.1.31022 WP_000778528.1.31039 WP_000778528.1.31048 WP_000778528.1.31091 WP_000778528.1.31176 WP_000778528.1.31206 WP_000778528.1.3123 WP_000778528.1.31315 WP_000778528.1.31337 WP_000778528.1.31339 WP_000778528.1.31355 WP_000778528.1.31437 WP_000778528.1.31442 WP_000778528.1.31468 WP_000778528.1.31479 WP_000778528.1.31529 WP_000778528.1.31539 WP_000778528.1.31642 WP_000778528.1.31647 WP_000778528.1.31653 WP_000778528.1.31686 WP_000778528.1.31753 WP_000778528.1.31827 WP_000778528.1.31828 WP_000778528.1.31842 WP_000778528.1.31892 WP_000778528.1.31931 WP_000778528.1.31997 WP_000778528.1.32003 WP_000778528.1.32005 WP_000778528.1.32029 WP_000778528.1.32067 WP_000778528.1.32160 WP_000778528.1.32207 WP_000778528.1.3229 WP_000778528.1.32339 WP_000778528.1.32474 WP_000778528.1.32481 WP_000778528.1.32483 WP_000778528.1.32514 WP_000778528.1.32534 WP_000778528.1.32565 WP_000778528.1.32607 WP_000778528.1.32645 WP_000778528.1.32746 WP_000778528.1.32764 WP_000778528.1.32770 WP_000778528.1.32800 WP_000778528.1.32928 WP_000778528.1.32939 WP_000778528.1.32954 WP_000778528.1.33038 WP_000778528.1.33110 WP_000778528.1.33123 WP_000778528.1.33138 WP_000778528.1.33212 WP_000778528.1.33250 WP_000778528.1.33266 WP_000778528.1.33335 WP_000778528.1.33357 WP_000778528.1.33416 WP_000778528.1.3342 WP_000778528.1.33432 WP_000778528.1.33468 WP_000778528.1.3347 WP_000778528.1.33507 WP_000778528.1.33626 WP_000778528.1.33627 WP_000778528.1.3363 WP_000778528.1.33654 WP_000778528.1.33692 WP_000778528.1.33695 WP_000778528.1.33718 WP_000778528.1.33735 WP_000778528.1.33743 WP_000778528.1.33769 WP_000778528.1.33792 WP_000778528.1.33804 WP_000778528.1.33813 WP_000778528.1.33968 WP_000778528.1.33971 WP_000778528.1.34026 WP_000778528.1.34030 WP_000778528.1.34051 WP_000778528.1.34062 WP_000778528.1.34100 WP_000778528.1.34132 WP_000778528.1.34182 WP_000778528.1.34209 WP_000778528.1.34244 WP_000778528.1.34250 WP_000778528.1.34251 WP_000778528.1.34285 WP_000778528.1.34381 WP_000778528.1.34403 WP_000778528.1.34410 WP_000778528.1.34482 WP_000778528.1.34492 WP_000778528.1.34502 WP_000778528.1.34510 WP_000778528.1.34526 WP_000778528.1.3461 WP_000778528.1.34677 WP_000778528.1.34737 WP_000778528.1.34767 WP_000778528.1.34818 WP_000778528.1.34890 WP_000778528.1.34918 WP_000778528.1.34998 WP_000778528.1.35059 WP_000778528.1.35062 WP_000778528.1.35089 WP_000778528.1.35097 WP_000778528.1.35110 WP_000778528.1.35121 WP_000778528.1.35233 WP_000778528.1.35276 WP_000778528.1.35297 WP_000778528.1.35334 WP_000778528.1.35342 WP_000778528.1.354 WP_000778528.1.35415 WP_000778528.1.35498 WP_000778528.1.35525 WP_000778528.1.35580 WP_000778528.1.35615 WP_000778528.1.35623 WP_000778528.1.35673 WP_000778528.1.3569 WP_000778528.1.35801 WP_000778528.1.35826 WP_000778528.1.35900 WP_000778528.1.35928 WP_000778528.1.35950 WP_000778528.1.36004 WP_000778528.1.36082 WP_000778528.1.36102 WP_000778528.1.36119 WP_000778528.1.36141 WP_000778528.1.3617 WP_000778528.1.36187 WP_000778528.1.36188 WP_000778528.1.36250 WP_000778528.1.36264 WP_000778528.1.36278 WP_000778528.1.36282 WP_000778528.1.36307 WP_000778528.1.36344 WP_000778528.1.36389 WP_000778528.1.36532 WP_000778528.1.36535 WP_000778528.1.3655 WP_000778528.1.36570 WP_000778528.1.36580 WP_000778528.1.36600 WP_000778528.1.36615 WP_000778528.1.36646 WP_000778528.1.3666 WP_000778528.1.36689 WP_000778528.1.36697 WP_000778528.1.36745 WP_000778528.1.3675 WP_000778528.1.36783 WP_000778528.1.36796 WP_000778528.1.36822 WP_000778528.1.3685 WP_000778528.1.36858 WP_000778528.1.3687 WP_000778528.1.36955 WP_000778528.1.36979 WP_000778528.1.36980 WP_000778528.1.36997 WP_000778528.1.37002 WP_000778528.1.37016 WP_000778528.1.3703 WP_000778528.1.37044 WP_000778528.1.37055 WP_000778528.1.37080 WP_000778528.1.37121 WP_000778528.1.37134 WP_000778528.1.37220 WP_000778528.1.37341 WP_000778528.1.37398 WP_000778528.1.37424 WP_000778528.1.37467 WP_000778528.1.37583 WP_000778528.1.37602 WP_000778528.1.37605 WP_000778528.1.37606 WP_000778528.1.37621 WP_000778528.1.37624 WP_000778528.1.3776 WP_000778528.1.37781 WP_000778528.1.37815 WP_000778528.1.37828 WP_000778528.1.37953 WP_000778528.1.37987 WP_000778528.1.38038 WP_000778528.1.38057 WP_000778528.1.38070 WP_000778528.1.38082 WP_000778528.1.3809 WP_000778528.1.38160 WP_000778528.1.38177 WP_000778528.1.3820 WP_000778528.1.38230 WP_000778528.1.38232 WP_000778528.1.38276 WP_000778528.1.38309 WP_000778528.1.38339 WP_000778528.1.38383 WP_000778528.1.3842 WP_000778528.1.38437 WP_000778528.1.38453 WP_000778528.1.38493 WP_000778528.1.38546 WP_000778528.1.38607 WP_000778528.1.3867 WP_000778528.1.38674 WP_000778528.1.38721 WP_000778528.1.38760 WP_000778528.1.38823 WP_000778528.1.38841 WP_000778528.1.38858 WP_000778528.1.38926 WP_000778528.1.38931 WP_000778528.1.38940 WP_000778528.1.38941 WP_000778528.1.38972 WP_000778528.1.38989 WP_000778528.1.390 WP_000778528.1.39012 WP_000778528.1.39014 WP_000778528.1.39043 WP_000778528.1.3906 WP_000778528.1.39108 WP_000778528.1.39203 WP_000778528.1.39206 WP_000778528.1.39217 WP_000778528.1.3926 WP_000778528.1.39272 WP_000778528.1.39290 WP_000778528.1.39332 WP_000778528.1.39333 WP_000778528.1.39397 WP_000778528.1.39486 WP_000778528.1.39506 WP_000778528.1.39550 WP_000778528.1.39645 WP_000778528.1.39687 WP_000778528.1.39689 WP_000778528.1.39697 WP_000778528.1.39711 WP_000778528.1.39738 WP_000778528.1.39767 WP_000778528.1.39789 WP_000778528.1.39832 WP_000778528.1.39838 WP_000778528.1.39856 WP_000778528.1.39869 WP_000778528.1.40014 WP_000778528.1.40043 WP_000778528.1.40099 WP_000778528.1.40120 WP_000778528.1.40137 WP_000778528.1.4015 WP_000778528.1.40164 WP_000778528.1.40173 WP_000778528.1.4019 WP_000778528.1.40320 WP_000778528.1.40330 WP_000778528.1.40342 WP_000778528.1.40368 WP_000778528.1.40406 WP_000778528.1.4045 WP_000778528.1.40474 WP_000778528.1.40481 WP_000778528.1.40505 WP_000778528.1.40531 WP_000778528.1.40532 WP_000778528.1.4056 WP_000778528.1.40579 WP_000778528.1.40588 WP_000778528.1.40644 WP_000778528.1.40655 WP_000778528.1.40658 WP_000778528.1.40659 WP_000778528.1.40760 WP_000778528.1.40797 WP_000778528.1.40816 WP_000778528.1.41084 WP_000778528.1.41094 WP_000778528.1.41119 WP_000778528.1.41129 WP_000778528.1.4115 WP_000778528.1.41178 WP_000778528.1.41208 WP_000778528.1.41241 WP_000778528.1.41255 WP_000778528.1.41289 WP_000778528.1.4129 WP_000778528.1.41426 WP_000778528.1.41432 WP_000778528.1.41433 WP_000778528.1.41499 WP_000778528.1.41558 WP_000778528.1.41567 WP_000778528.1.41582 WP_000778528.1.41674 WP_000778528.1.41839 WP_000778528.1.4188 WP_000778528.1.41898 WP_000778528.1.41935 WP_000778528.1.41943 WP_000778528.1.41989 WP_000778528.1.420 WP_000778528.1.42015 WP_000778528.1.42017 WP_000778528.1.42028 WP_000778528.1.42087 WP_000778528.1.42125 WP_000778528.1.42137 WP_000778528.1.42198 WP_000778528.1.42269 WP_000778528.1.42305 WP_000778528.1.42355 WP_000778528.1.42403 WP_000778528.1.42436 WP_000778528.1.42459 WP_000778528.1.42481 WP_000778528.1.42510 WP_000778528.1.42593 WP_000778528.1.426 WP_000778528.1.42640 WP_000778528.1.42652 WP_000778528.1.42668 WP_000778528.1.42674 WP_000778528.1.42737 WP_000778528.1.42759 WP_000778528.1.42786 WP_000778528.1.42837 WP_000778528.1.4293 WP_000778528.1.43014 WP_000778528.1.43047 WP_000778528.1.43072 WP_000778528.1.43131 WP_000778528.1.43143 WP_000778528.1.43147 WP_000778528.1.43159 WP_000778528.1.43165 WP_000778528.1.43202 WP_000778528.1.43232 WP_000778528.1.43248 WP_000778528.1.4325 WP_000778528.1.43263 WP_000778528.1.4327 WP_000778528.1.43274 WP_000778528.1.43323 WP_000778528.1.43341 WP_000778528.1.43349 WP_000778528.1.43369 WP_000778528.1.4337 WP_000778528.1.43406 WP_000778528.1.4341 WP_000778528.1.43460 WP_000778528.1.43560 WP_000778528.1.43617 WP_000778528.1.43618 WP_000778528.1.43627 WP_000778528.1.43659 WP_000778528.1.43670 WP_000778528.1.43702 WP_000778528.1.43703 WP_000778528.1.4372 WP_000778528.1.43731 WP_000778528.1.43752 WP_000778528.1.43788 WP_000778528.1.43819 WP_000778528.1.43827 WP_000778528.1.4385 WP_000778528.1.43904 WP_000778528.1.43915 WP_000778528.1.44119 WP_000778528.1.44153 WP_000778528.1.44181 WP_000778528.1.44195 WP_000778528.1.44265 WP_000778528.1.44302 WP_000778528.1.44388 WP_000778528.1.44396 WP_000778528.1.44405 WP_000778528.1.44420 WP_000778528.1.44544 WP_000778528.1.44579 WP_000778528.1.44588 WP_000778528.1.44605 WP_000778528.1.44631 WP_000778528.1.44672 WP_000778528.1.44732 WP_000778528.1.44755 WP_000778528.1.44785 WP_000778528.1.44788 WP_000778528.1.44796 WP_000778528.1.44881 WP_000778528.1.44882 WP_000778528.1.44914 WP_000778528.1.44955 WP_000778528.1.44969 WP_000778528.1.45033 WP_000778528.1.45035 WP_000778528.1.45099 WP_000778528.1.4513 WP_000778528.1.45133 WP_000778528.1.45164 WP_000778528.1.45170 WP_000778528.1.45272 WP_000778528.1.45290 WP_000778528.1.45297 WP_000778528.1.453 WP_000778528.1.45364 WP_000778528.1.45439 WP_000778528.1.45472 WP_000778528.1.4550 WP_000778528.1.45507 WP_000778528.1.45560 WP_000778528.1.45577 WP_000778528.1.45670 WP_000778528.1.45703 WP_000778528.1.45730 WP_000778528.1.45734 WP_000778528.1.45768 WP_000778528.1.45771 WP_000778528.1.45780 WP_000778528.1.4584 WP_000778528.1.45852 WP_000778528.1.45897 WP_000778528.1.45954 WP_000778528.1.4598 WP_000778528.1.46003 WP_000778528.1.46005 WP_000778528.1.46055 WP_000778528.1.46087 WP_000778528.1.46208 WP_000778528.1.46222 WP_000778528.1.46228 WP_000778528.1.46276 WP_000778528.1.46330 WP_000778528.1.46334 WP_000778528.1.46362 WP_000778528.1.46368 WP_000778528.1.46380 WP_000778528.1.46401 WP_000778528.1.46422 WP_000778528.1.46465 WP_000778528.1.46543 WP_000778528.1.4662 WP_000778528.1.46660 WP_000778528.1.46664 WP_000778528.1.46692 WP_000778528.1.46702 WP_000778528.1.46703 WP_000778528.1.46752 WP_000778528.1.46765 WP_000778528.1.46852 WP_000778528.1.46908 WP_000778528.1.46925 WP_000778528.1.46937 WP_000778528.1.46983 WP_000778528.1.47051 WP_000778528.1.47128 WP_000778528.1.47159 WP_000778528.1.47163 WP_000778528.1.47187 WP_000778528.1.47211 WP_000778528.1.47216 WP_000778528.1.47258 WP_000778528.1.47269 WP_000778528.1.47279 WP_000778528.1.4728 WP_000778528.1.47290 WP_000778528.1.47306 WP_000778528.1.47328 WP_000778528.1.47381 WP_000778528.1.47399 WP_000778528.1.47406 WP_000778528.1.47426 WP_000778528.1.47432 WP_000778528.1.47439 WP_000778528.1.47560 WP_000778528.1.47618 WP_000778528.1.4767 WP_000778528.1.477 WP_000778528.1.47733 WP_000778528.1.47763 WP_000778528.1.47782 WP_000778528.1.47836 WP_000778528.1.47859 WP_000778528.1.47872 WP_000778528.1.47873 WP_000778528.1.47904 WP_000778528.1.47996 WP_000778528.1.48011 WP_000778528.1.48030 WP_000778528.1.48047 WP_000778528.1.4805 WP_000778528.1.48149 WP_000778528.1.48154 WP_000778528.1.48169 WP_000778528.1.48186 WP_000778528.1.48227 WP_000778528.1.48236 WP_000778528.1.48250 WP_000778528.1.48284 WP_000778528.1.48293 WP_000778528.1.48307 WP_000778528.1.48322 WP_000778528.1.48391 WP_000778528.1.48394 WP_000778528.1.48463 WP_000778528.1.48563 WP_000778528.1.48577 WP_000778528.1.48593 WP_000778528.1.48634 WP_000778528.1.48656 WP_000778528.1.4868 WP_000778528.1.48705 WP_000778528.1.48805 WP_000778528.1.48823 WP_000778528.1.48833 WP_000778528.1.48835 WP_000778528.1.4886 WP_000778528.1.48936 WP_000778528.1.48941 WP_000778528.1.48945 WP_000778528.1.48951 WP_000778528.1.48968 WP_000778528.1.48982 WP_000778528.1.48993 WP_000778528.1.4901 WP_000778528.1.4905 WP_000778528.1.49129 WP_000778528.1.49159 WP_000778528.1.4916 WP_000778528.1.49161 WP_000778528.1.4917 WP_000778528.1.4918 WP_000778528.1.49207 WP_000778528.1.49248 WP_000778528.1.49327 WP_000778528.1.49398 WP_000778528.1.4962 WP_000778528.1.49653 WP_000778528.1.49669 WP_000778528.1.49730 WP_000778528.1.49742 WP_000778528.1.4980 WP_000778528.1.49800 WP_000778528.1.49860 WP_000778528.1.49863 WP_000778528.1.49871 WP_000778528.1.4989 WP_000778528.1.49894 WP_000778528.1.49934 WP_000778528.1.4994 WP_000778528.1.49970 WP_000778528.1.49982 WP_000778528.1.50013 WP_000778528.1.50038 WP_000778528.1.50061 WP_000778528.1.50076 WP_000778528.1.5013 WP_000778528.1.50138 WP_000778528.1.50217 WP_000778528.1.50219 WP_000778528.1.50261 WP_000778528.1.50313 WP_000778528.1.50314 WP_000778528.1.50356 WP_000778528.1.50425 WP_000778528.1.50536 WP_000778528.1.50578 WP_000778528.1.50595 WP_000778528.1.50660 WP_000778528.1.50768 WP_000778528.1.50799 WP_000778528.1.50820 WP_000778528.1.50896 WP_000778528.1.50937 WP_000778528.1.50962 WP_000778528.1.5109 WP_000778528.1.5110 WP_000778528.1.5111 WP_000778528.1.51236 WP_000778528.1.51245 WP_000778528.1.51250 WP_000778528.1.51282 WP_000778528.1.51295 WP_000778528.1.51306 WP_000778528.1.51310 WP_000778528.1.51346 WP_000778528.1.51376 WP_000778528.1.51403 WP_000778528.1.51454 WP_000778528.1.51456 WP_000778528.1.51492 WP_000778528.1.51527 WP_000778528.1.51559 WP_000778528.1.51575 WP_000778528.1.51590 WP_000778528.1.51665 WP_000778528.1.51716 WP_000778528.1.51748 WP_000778528.1.51797 WP_000778528.1.51836 WP_000778528.1.51842 WP_000778528.1.51871 WP_000778528.1.51883 WP_000778528.1.51924 WP_000778528.1.51936 WP_000778528.1.51952 WP_000778528.1.51971 WP_000778528.1.51995 WP_000778528.1.52078 WP_000778528.1.521 WP_000778528.1.5213 WP_000778528.1.52151 WP_000778528.1.52182 WP_000778528.1.52193 WP_000778528.1.52251 WP_000778528.1.52296 WP_000778528.1.523 WP_000778528.1.52322 WP_000778528.1.52327 WP_000778528.1.52331 WP_000778528.1.52340 WP_000778528.1.52440 WP_000778528.1.52442 WP_000778528.1.52463 WP_000778528.1.52518 WP_000778528.1.52548 WP_000778528.1.52595 WP_000778528.1.52624 WP_000778528.1.52645 WP_000778528.1.52715 WP_000778528.1.52848 WP_000778528.1.52877 WP_000778528.1.52878 WP_000778528.1.52941 WP_000778528.1.52947 WP_000778528.1.52984 WP_000778528.1.53071 WP_000778528.1.53140 WP_000778528.1.53153 WP_000778528.1.53209 WP_000778528.1.53260 WP_000778528.1.53317 WP_000778528.1.53319 WP_000778528.1.53387 WP_000778528.1.53394 WP_000778528.1.53403 WP_000778528.1.53432 WP_000778528.1.53462 WP_000778528.1.53521 WP_000778528.1.53577 WP_000778528.1.53641 WP_000778528.1.53648 WP_000778528.1.53671 WP_000778528.1.53766 WP_000778528.1.53827 WP_000778528.1.53835 WP_000778528.1.53889 WP_000778528.1.53915 WP_000778528.1.53934 WP_000778528.1.53969 WP_000778528.1.53999 WP_000778528.1.5401 WP_000778528.1.54022 WP_000778528.1.54109 WP_000778528.1.54147 WP_000778528.1.54229 WP_000778528.1.54297 WP_000778528.1.54395 WP_000778528.1.544 WP_000778528.1.54413 WP_000778528.1.54503 WP_000778528.1.54551 WP_000778528.1.54637 WP_000778528.1.54675 WP_000778528.1.5469 WP_000778528.1.54745 WP_000778528.1.54753 WP_000778528.1.54878 WP_000778528.1.54955 WP_000778528.1.55014 WP_000778528.1.5519 WP_000778528.1.55214 WP_000778528.1.55274 WP_000778528.1.55309 WP_000778528.1.55367 WP_000778528.1.55369 WP_000778528.1.55403 WP_000778528.1.55405 WP_000778528.1.55421 WP_000778528.1.55508 WP_000778528.1.5554 WP_000778528.1.55544 WP_000778528.1.5556 WP_000778528.1.55583 WP_000778528.1.5559 WP_000778528.1.55628 WP_000778528.1.55637 WP_000778528.1.55653 WP_000778528.1.557 WP_000778528.1.55728 WP_000778528.1.55786 WP_000778528.1.5580 WP_000778528.1.55831 WP_000778528.1.55835 WP_000778528.1.55867 WP_000778528.1.55886 WP_000778528.1.5589 WP_000778528.1.55904 WP_000778528.1.55916 WP_000778528.1.55933 WP_000778528.1.55953 WP_000778528.1.56000 WP_000778528.1.56025 WP_000778528.1.56048 WP_000778528.1.56078 WP_000778528.1.56098 WP_000778528.1.56225 WP_000778528.1.5623 WP_000778528.1.56239 WP_000778528.1.56281 WP_000778528.1.56333 WP_000778528.1.5635 WP_000778528.1.56400 WP_000778528.1.5644 WP_000778528.1.56558 WP_000778528.1.5658 WP_000778528.1.566 WP_000778528.1.56628 WP_000778528.1.56658 WP_000778528.1.5677 WP_000778528.1.56794 WP_000778528.1.56815 WP_000778528.1.56856 WP_000778528.1.5686 WP_000778528.1.56865 WP_000778528.1.56878 WP_000778528.1.56986 WP_000778528.1.57047 WP_000778528.1.57073 WP_000778528.1.57075 WP_000778528.1.57097 WP_000778528.1.57109 WP_000778528.1.57170 WP_000778528.1.5718 WP_000778528.1.57190 WP_000778528.1.57214 WP_000778528.1.57265 WP_000778528.1.57309 WP_000778528.1.57445 WP_000778528.1.57481 WP_000778528.1.57594 WP_000778528.1.57650 WP_000778528.1.57665 WP_000778528.1.57682 WP_000778528.1.57692 WP_000778528.1.57730 WP_000778528.1.57734 WP_000778528.1.57754 WP_000778528.1.57808 WP_000778528.1.57819 WP_000778528.1.57837 WP_000778528.1.57840 WP_000778528.1.57861 WP_000778528.1.57943 WP_000778528.1.57952 WP_000778528.1.57974 WP_000778528.1.58016 WP_000778528.1.58049 WP_000778528.1.58074 WP_000778528.1.58116 WP_000778528.1.58127 WP_000778528.1.58148 WP_000778528.1.58158 WP_000778528.1.5816 WP_000778528.1.58277 WP_000778528.1.58317 WP_000778528.1.58352 WP_000778528.1.58364 WP_000778528.1.58395 WP_000778528.1.58430 WP_000778528.1.58435 WP_000778528.1.58512 WP_000778528.1.58530 WP_000778528.1.5857 WP_000778528.1.58571 WP_000778528.1.58592 WP_000778528.1.58598 WP_000778528.1.58704 WP_000778528.1.58735 WP_000778528.1.58760 WP_000778528.1.58763 WP_000778528.1.58772 WP_000778528.1.5880 WP_000778528.1.58833 WP_000778528.1.58934 WP_000778528.1.58981 WP_000778528.1.59011 WP_000778528.1.59014 WP_000778528.1.59039 WP_000778528.1.59077 WP_000778528.1.59098 WP_000778528.1.59124 WP_000778528.1.59146 WP_000778528.1.5920 WP_000778528.1.59311 WP_000778528.1.59398 WP_000778528.1.59404 WP_000778528.1.59462 WP_000778528.1.59464 WP_000778528.1.59498 WP_000778528.1.59540 WP_000778528.1.59546 WP_000778528.1.59598 WP_000778528.1.59668 WP_000778528.1.59669 WP_000778528.1.59671 WP_000778528.1.5972 WP_000778528.1.5982 WP_000778528.1.59822 WP_000778528.1.59874 WP_000778528.1.59907 WP_000778528.1.59915 WP_000778528.1.60006 WP_000778528.1.6006 WP_000778528.1.6011 WP_000778528.1.60123 WP_000778528.1.60149 WP_000778528.1.60157 WP_000778528.1.6017 WP_000778528.1.60227 WP_000778528.1.60302 WP_000778528.1.60353 WP_000778528.1.60360 WP_000778528.1.60434 WP_000778528.1.60547 WP_000778528.1.60585 WP_000778528.1.60595 WP_000778528.1.60636 WP_000778528.1.60641 WP_000778528.1.60734 WP_000778528.1.60750 WP_000778528.1.60751 WP_000778528.1.60759 WP_000778528.1.60765 WP_000778528.1.60778 WP_000778528.1.60813 WP_000778528.1.60820 WP_000778528.1.60845 WP_000778528.1.6085 WP_000778528.1.60869 WP_000778528.1.60888 WP_000778528.1.60912 WP_000778528.1.60923 WP_000778528.1.60948 WP_000778528.1.60965 WP_000778528.1.61013 WP_000778528.1.61023 WP_000778528.1.61026 WP_000778528.1.61029 WP_000778528.1.61031 WP_000778528.1.61115 WP_000778528.1.61139 WP_000778528.1.61189 WP_000778528.1.6119 WP_000778528.1.6123 WP_000778528.1.61263 WP_000778528.1.61271 WP_000778528.1.61286 WP_000778528.1.61289 WP_000778528.1.61313 WP_000778528.1.61316 WP_000778528.1.6136 WP_000778528.1.61375 WP_000778528.1.61439 WP_000778528.1.61440 WP_000778528.1.61555 WP_000778528.1.61585 WP_000778528.1.61597 WP_000778528.1.61639 WP_000778528.1.6166 WP_000778528.1.61705 WP_000778528.1.61749 WP_000778528.1.61802 WP_000778528.1.61838 WP_000778528.1.61903 WP_000778528.1.61936 WP_000778528.1.61978 WP_000778528.1.62002 WP_000778528.1.6201 WP_000778528.1.62028 WP_000778528.1.62069 WP_000778528.1.62071 WP_000778528.1.62096 WP_000778528.1.62247 WP_000778528.1.62254 WP_000778528.1.62346 WP_000778528.1.62352 WP_000778528.1.62382 WP_000778528.1.62398 WP_000778528.1.62429 WP_000778528.1.62453 WP_000778528.1.62474 WP_000778528.1.62496 WP_000778528.1.6250 WP_000778528.1.62553 WP_000778528.1.62602 WP_000778528.1.62653 WP_000778528.1.62671 WP_000778528.1.62674 WP_000778528.1.6268 WP_000778528.1.62684 WP_000778528.1.62723 WP_000778528.1.62771 WP_000778528.1.62822 WP_000778528.1.62824 WP_000778528.1.62831 WP_000778528.1.62863 WP_000778528.1.62880 WP_000778528.1.62970 WP_000778528.1.63003 WP_000778528.1.63027 WP_000778528.1.63052 WP_000778528.1.63070 WP_000778528.1.63083 WP_000778528.1.63139 WP_000778528.1.63140 WP_000778528.1.63220 WP_000778528.1.63266 WP_000778528.1.63289 WP_000778528.1.63304 WP_000778528.1.63313 WP_000778528.1.63333 WP_000778528.1.63341 WP_000778528.1.63441 WP_000778528.1.63469 WP_000778528.1.63471 WP_000778528.1.63589 WP_000778528.1.63673 WP_000778528.1.63678 WP_000778528.1.63726 WP_000778528.1.63729 WP_000778528.1.63751 WP_000778528.1.63759 WP_000778528.1.63774 WP_000778528.1.63828 WP_000778528.1.63907 WP_000778528.1.6403 WP_000778528.1.6408 WP_000778528.1.64192 WP_000778528.1.64250 WP_000778528.1.64367 WP_000778528.1.6438 WP_000778528.1.64456 WP_000778528.1.64457 WP_000778528.1.64525 WP_000778528.1.64565 WP_000778528.1.64583 WP_000778528.1.6459 WP_000778528.1.6462 WP_000778528.1.64677 WP_000778528.1.64686 WP_000778528.1.64720 WP_000778528.1.64765 WP_000778528.1.6479 WP_000778528.1.64858 WP_000778528.1.64879 WP_000778528.1.6488 WP_000778528.1.64893 WP_000778528.1.64897 WP_000778528.1.64935 WP_000778528.1.64961 WP_000778528.1.65044 WP_000778528.1.65132 WP_000778528.1.65158 WP_000778528.1.65180 WP_000778528.1.65193 WP_000778528.1.65217 WP_000778528.1.65317 WP_000778528.1.65367 WP_000778528.1.65419 WP_000778528.1.65423 WP_000778528.1.65432 WP_000778528.1.65443 WP_000778528.1.65451 WP_000778528.1.6547 WP_000778528.1.65504 WP_000778528.1.6551 WP_000778528.1.65520 WP_000778528.1.65544 WP_000778528.1.65562 WP_000778528.1.65675 WP_000778528.1.65689 WP_000778528.1.65693 WP_000778528.1.65700 WP_000778528.1.65703 WP_000778528.1.65705 WP_000778528.1.65856 WP_000778528.1.65931 WP_000778528.1.66009 WP_000778528.1.66081 WP_000778528.1.66133 WP_000778528.1.66175 WP_000778528.1.66262 WP_000778528.1.66302 WP_000778528.1.66433 WP_000778528.1.66505 WP_000778528.1.66519 WP_000778528.1.66542 WP_000778528.1.66564 WP_000778528.1.66588 WP_000778528.1.66601 WP_000778528.1.66606 WP_000778528.1.66664 WP_000778528.1.66677 WP_000778528.1.66711 WP_000778528.1.66786 WP_000778528.1.66818 WP_000778528.1.6684 WP_000778528.1.67112 WP_000778528.1.67135 WP_000778528.1.67191 WP_000778528.1.6722 WP_000778528.1.67266 WP_000778528.1.67329 WP_000778528.1.67333 WP_000778528.1.67379 WP_000778528.1.6740 WP_000778528.1.67414 WP_000778528.1.67463 WP_000778528.1.67480 WP_000778528.1.67505 WP_000778528.1.67507 WP_000778528.1.67521 WP_000778528.1.67554 WP_000778528.1.67572 WP_000778528.1.67632 WP_000778528.1.67651 WP_000778528.1.67652 WP_000778528.1.67713 WP_000778528.1.67722 WP_000778528.1.67754 WP_000778528.1.67815 WP_000778528.1.6786 WP_000778528.1.67865 WP_000778528.1.67925 WP_000778528.1.68033 WP_000778528.1.68054 WP_000778528.1.6811 WP_000778528.1.68111 WP_000778528.1.68160 WP_000778528.1.68199 WP_000778528.1.68261 WP_000778528.1.68295 WP_000778528.1.6830 WP_000778528.1.68307 WP_000778528.1.6834 WP_000778528.1.68343 WP_000778528.1.68351 WP_000778528.1.68367 WP_000778528.1.68404 WP_000778528.1.68425 WP_000778528.1.68483 WP_000778528.1.68489 WP_000778528.1.68522 WP_000778528.1.68565 WP_000778528.1.68650 WP_000778528.1.68699 WP_000778528.1.68703 WP_000778528.1.68728 WP_000778528.1.68775 WP_000778528.1.68813 WP_000778528.1.68831 WP_000778528.1.68854 WP_000778528.1.68875 WP_000778528.1.68943 WP_000778528.1.68944 WP_000778528.1.69045 WP_000778528.1.69087 WP_000778528.1.69089 WP_000778528.1.6917 WP_000778528.1.69191 WP_000778528.1.69219 WP_000778528.1.69222 WP_000778528.1.69237 WP_000778528.1.69366 WP_000778528.1.69395 WP_000778528.1.69415 WP_000778528.1.69476 WP_000778528.1.69480 WP_000778528.1.695 WP_000778528.1.69563 WP_000778528.1.69622 WP_000778528.1.69679 WP_000778528.1.69877 WP_000778528.1.69878 WP_000778528.1.69921 WP_000778528.1.69987 WP_000778528.1.70024 WP_000778528.1.70048 WP_000778528.1.70105 WP_000778528.1.7012 WP_000778528.1.70133 WP_000778528.1.7024 WP_000778528.1.70253 WP_000778528.1.70273 WP_000778528.1.7034 WP_000778528.1.70344 WP_000778528.1.70349 WP_000778528.1.7043 WP_000778528.1.70451 WP_000778528.1.70459 WP_000778528.1.70462 WP_000778528.1.7053 WP_000778528.1.7061 WP_000778528.1.70635 WP_000778528.1.70641 WP_000778528.1.7067 WP_000778528.1.7073 WP_000778528.1.70818 WP_000778528.1.70823 WP_000778528.1.70855 WP_000778528.1.70924 WP_000778528.1.70930 WP_000778528.1.70943 WP_000778528.1.71043 WP_000778528.1.71058 WP_000778528.1.71059 WP_000778528.1.71073 WP_000778528.1.7109 WP_000778528.1.71130 WP_000778528.1.71196 WP_000778528.1.7120 WP_000778528.1.7125 WP_000778528.1.71257 WP_000778528.1.71295 WP_000778528.1.71298 WP_000778528.1.71325 WP_000778528.1.71345 WP_000778528.1.71359 WP_000778528.1.71463 WP_000778528.1.71519 WP_000778528.1.71529 WP_000778528.1.71543 WP_000778528.1.71596 WP_000778528.1.71602 WP_000778528.1.7161 WP_000778528.1.71662 WP_000778528.1.71676 WP_000778528.1.7179 WP_000778528.1.71925 WP_000778528.1.71989 WP_000778528.1.72026 WP_000778528.1.72031 WP_000778528.1.72067 WP_000778528.1.72169 WP_000778528.1.72205 WP_000778528.1.72271 WP_000778528.1.72330 WP_000778528.1.72347 WP_000778528.1.7236 WP_000778528.1.72366 WP_000778528.1.72424 WP_000778528.1.72547 WP_000778528.1.72654 WP_000778528.1.72787 WP_000778528.1.72832 WP_000778528.1.72834 WP_000778528.1.72835 WP_000778528.1.72903 WP_000778528.1.72935 WP_000778528.1.72945 WP_000778528.1.73017 WP_000778528.1.73022 WP_000778528.1.73037 WP_000778528.1.73122 WP_000778528.1.73132 WP_000778528.1.73246 WP_000778528.1.73265 WP_000778528.1.73286 WP_000778528.1.73386 WP_000778528.1.73456 WP_000778528.1.73501 WP_000778528.1.73571 WP_000778528.1.73591 WP_000778528.1.736 WP_000778528.1.73639 WP_000778528.1.73685 WP_000778528.1.73735 WP_000778528.1.73759 WP_000778528.1.73786 WP_000778528.1.7380 WP_000778528.1.73834 WP_000778528.1.73858 WP_000778528.1.73910 WP_000778528.1.73920 WP_000778528.1.73961 WP_000778528.1.73969 WP_000778528.1.73976 WP_000778528.1.73983 WP_000778528.1.74006 WP_000778528.1.74010 WP_000778528.1.74027 WP_000778528.1.74081 WP_000778528.1.74157 WP_000778528.1.74161 WP_000778528.1.74173 WP_000778528.1.74183 WP_000778528.1.74216 WP_000778528.1.74234 WP_000778528.1.74237 WP_000778528.1.7427 WP_000778528.1.7434 WP_000778528.1.74353 WP_000778528.1.74356 WP_000778528.1.74380 WP_000778528.1.74429 WP_000778528.1.74457 WP_000778528.1.7457 WP_000778528.1.74587 WP_000778528.1.74610 WP_000778528.1.74638 WP_000778528.1.74696 WP_000778528.1.74704 WP_000778528.1.74731 WP_000778528.1.74747 WP_000778528.1.74802 WP_000778528.1.74866 WP_000778528.1.74890 WP_000778528.1.74911 WP_000778528.1.74922 WP_000778528.1.74961 WP_000778528.1.74999 WP_000778528.1.75038 WP_000778528.1.75052 WP_000778528.1.75186 WP_000778528.1.75227 WP_000778528.1.75252 WP_000778528.1.75253 WP_000778528.1.75294 WP_000778528.1.75298 WP_000778528.1.75320 WP_000778528.1.75327 WP_000778528.1.75365 WP_000778528.1.75399 WP_000778528.1.7542 WP_000778528.1.75438 WP_000778528.1.75440 WP_000778528.1.75527 WP_000778528.1.75551 WP_000778528.1.7561 WP_000778528.1.75649 WP_000778528.1.75652 WP_000778528.1.75685 WP_000778528.1.75775 WP_000778528.1.75830 WP_000778528.1.75881 WP_000778528.1.75885 WP_000778528.1.75929 WP_000778528.1.75952 WP_000778528.1.7596 WP_000778528.1.75969 WP_000778528.1.76015 WP_000778528.1.76095 WP_000778528.1.76143 WP_000778528.1.76230 WP_000778528.1.76234 WP_000778528.1.7624 WP_000778528.1.7625 WP_000778528.1.76258 WP_000778528.1.76261 WP_000778528.1.76332 WP_000778528.1.76337 WP_000778528.1.76351 WP_000778528.1.76419 WP_000778528.1.76420 WP_000778528.1.76421 WP_000778528.1.76606 WP_000778528.1.76624 WP_000778528.1.76648 WP_000778528.1.76686 WP_000778528.1.76690 WP_000778528.1.76693 WP_000778528.1.7675 WP_000778528.1.76790 WP_000778528.1.76792 WP_000778528.1.768 WP_000778528.1.76816 WP_000778528.1.76839 WP_000778528.1.76845 WP_000778528.1.76897 WP_000778528.1.76944 WP_000778528.1.76998 WP_000778528.1.77031 WP_000778528.1.77041 WP_000778528.1.77050 WP_000778528.1.77060 WP_000778528.1.77062 WP_000778528.1.77112 WP_000778528.1.77145 WP_000778528.1.77305 WP_000778528.1.7745 WP_000778528.1.7746 WP_000778528.1.77489 WP_000778528.1.77497 WP_000778528.1.77520 WP_000778528.1.77527 WP_000778528.1.77533 WP_000778528.1.77572 WP_000778528.1.77603 WP_000778528.1.77606 WP_000778528.1.77738 WP_000778528.1.77743 WP_000778528.1.77818 WP_000778528.1.77822 WP_000778528.1.77848 WP_000778528.1.77858 WP_000778528.1.7787 WP_000778528.1.77957 WP_000778528.1.78091 WP_000778528.1.78173 WP_000778528.1.78189 WP_000778528.1.78207 WP_000778528.1.78252 WP_000778528.1.78254 WP_000778528.1.78257 WP_000778528.1.7827 WP_000778528.1.78311 WP_000778528.1.78332 WP_000778528.1.78365 WP_000778528.1.78404 WP_000778528.1.7850 WP_000778528.1.78558 WP_000778528.1.7857 WP_000778528.1.78604 WP_000778528.1.78653 WP_000778528.1.78667 WP_000778528.1.78728 WP_000778528.1.78803 WP_000778528.1.78841 WP_000778528.1.78897 WP_000778528.1.78946 WP_000778528.1.78983 WP_000778528.1.7900 WP_000778528.1.79006 WP_000778528.1.79038 WP_000778528.1.79051 WP_000778528.1.79085 WP_000778528.1.79131 WP_000778528.1.79170 WP_000778528.1.79197 WP_000778528.1.79208 WP_000778528.1.79223 WP_000778528.1.7931 WP_000778528.1.79310 WP_000778528.1.79314 WP_000778528.1.79332 WP_000778528.1.79367 WP_000778528.1.79436 WP_000778528.1.79461 WP_000778528.1.79476 WP_000778528.1.79487 WP_000778528.1.79539 WP_000778528.1.79556 WP_000778528.1.79626 WP_000778528.1.79662 WP_000778528.1.79672 WP_000778528.1.79706 WP_000778528.1.79822 WP_000778528.1.79831 WP_000778528.1.79834 WP_000778528.1.79837 WP_000778528.1.7989 WP_000778528.1.79896 WP_000778528.1.79911 WP_000778528.1.7992 WP_000778528.1.79941 WP_000778528.1.79971 WP_000778528.1.79991 WP_000778528.1.80000 WP_000778528.1.80032 WP_000778528.1.80042 WP_000778528.1.80079 WP_000778528.1.80109 WP_000778528.1.80127 WP_000778528.1.80203 WP_000778528.1.80287 WP_000778528.1.80290 WP_000778528.1.8031 WP_000778528.1.80358 WP_000778528.1.80378 WP_000778528.1.8043 WP_000778528.1.80472 WP_000778528.1.80530 WP_000778528.1.80687 WP_000778528.1.80717 WP_000778528.1.80761 WP_000778528.1.80763 WP_000778528.1.80781 WP_000778528.1.80786 WP_000778528.1.80833 WP_000778528.1.8084 WP_000778528.1.80872 WP_000778528.1.80962 WP_000778528.1.81085 WP_000778528.1.81114 WP_000778528.1.81157 WP_000778528.1.81171 WP_000778528.1.81234 WP_000778528.1.8125 WP_000778528.1.81252 WP_000778528.1.8135 WP_000778528.1.81385 WP_000778528.1.81389 WP_000778528.1.8142 WP_000778528.1.8144 WP_000778528.1.81464 WP_000778528.1.81467 WP_000778528.1.81599 WP_000778528.1.81610 WP_000778528.1.81740 WP_000778528.1.81758 WP_000778528.1.81810 WP_000778528.1.81812 WP_000778528.1.81831 WP_000778528.1.81861 WP_000778528.1.81870 WP_000778528.1.81897 WP_000778528.1.81903 WP_000778528.1.81905 WP_000778528.1.81906 WP_000778528.1.81919 WP_000778528.1.81944 WP_000778528.1.81955 WP_000778528.1.81999 WP_000778528.1.82009 WP_000778528.1.8212 WP_000778528.1.82121 WP_000778528.1.82247 WP_000778528.1.82259 WP_000778528.1.82340 WP_000778528.1.82354 WP_000778528.1.82358 WP_000778528.1.82368 WP_000778528.1.82447 WP_000778528.1.8246 WP_000778528.1.82467 WP_000778528.1.82548 WP_000778528.1.82612 WP_000778528.1.82709 WP_000778528.1.82724 WP_000778528.1.82796 WP_000778528.1.8280 WP_000778528.1.82802 WP_000778528.1.82862 WP_000778528.1.8289 WP_000778528.1.82976 WP_000778528.1.82980 WP_000778528.1.83152 WP_000778528.1.83153 WP_000778528.1.83185 WP_000778528.1.83193 WP_000778528.1.83234 WP_000778528.1.83316 WP_000778528.1.83352 WP_000778528.1.83372 WP_000778528.1.83418 WP_000778528.1.83476 WP_000778528.1.83484 WP_000778528.1.83517 WP_000778528.1.83593 WP_000778528.1.83646 WP_000778528.1.83653 WP_000778528.1.83676 WP_000778528.1.83720 WP_000778528.1.83763 WP_000778528.1.83769 WP_000778528.1.83775 WP_000778528.1.83804 WP_000778528.1.83825 WP_000778528.1.8383 WP_000778528.1.83881 WP_000778528.1.83912 WP_000778528.1.83928 WP_000778528.1.83984 WP_000778528.1.84049 WP_000778528.1.84064 WP_000778528.1.84144 WP_000778528.1.84163 WP_000778528.1.84293 WP_000778528.1.84342 WP_000778528.1.84442 WP_000778528.1.84445 WP_000778528.1.84451 WP_000778528.1.84509 WP_000778528.1.84563 WP_000778528.1.84578 WP_000778528.1.84638 WP_000778528.1.8468 WP_000778528.1.84682 WP_000778528.1.8475 WP_000778528.1.84752 WP_000778528.1.84757 WP_000778528.1.84761 WP_000778528.1.84815 WP_000778528.1.84889 WP_000778528.1.84903 WP_000778528.1.84907 WP_000778528.1.84922 WP_000778528.1.8493 WP_000778528.1.85022 WP_000778528.1.85047 WP_000778528.1.85056 WP_000778528.1.85081 WP_000778528.1.85099 WP_000778528.1.85135 WP_000778528.1.85144 WP_000778528.1.85151 WP_000778528.1.85213 WP_000778528.1.85226 WP_000778528.1.85235 WP_000778528.1.85238 WP_000778528.1.85351 WP_000778528.1.85383 WP_000778528.1.85395 WP_000778528.1.85445 WP_000778528.1.85462 WP_000778528.1.85471 WP_000778528.1.85474 WP_000778528.1.85492 WP_000778528.1.85506 WP_000778528.1.85515 WP_000778528.1.85547 WP_000778528.1.85586 WP_000778528.1.85649 WP_000778528.1.85758 WP_000778528.1.85795 WP_000778528.1.85796 WP_000778528.1.85816 WP_000778528.1.85834 WP_000778528.1.85927 WP_000778528.1.85950 WP_000778528.1.85993 WP_000778528.1.86072 WP_000778528.1.86123 WP_000778528.1.86144 WP_000778528.1.86154 WP_000778528.1.86158 WP_000778528.1.86188 WP_000778528.1.8627 WP_000778528.1.86270 WP_000778528.1.86304 WP_000778528.1.86344 WP_000778528.1.86367 WP_000778528.1.86378 WP_000778528.1.8643 WP_000778528.1.86439 WP_000778528.1.86482 WP_000778528.1.86523 WP_000778528.1.86542 WP_000778528.1.86628 WP_000778528.1.86706 WP_000778528.1.86792 WP_000778528.1.8681 WP_000778528.1.86911 WP_000778528.1.86940 WP_000778528.1.86961 WP_000778528.1.86977 WP_000778528.1.87021 WP_000778528.1.87042 WP_000778528.1.87057 WP_000778528.1.87072 WP_000778528.1.87090 WP_000778528.1.87119 WP_000778528.1.87122 WP_000778528.1.87175 WP_000778528.1.87194 WP_000778528.1.8720 WP_000778528.1.87260 WP_000778528.1.87261 WP_000778528.1.87285 WP_000778528.1.87290 WP_000778528.1.8731 WP_000778528.1.87396 WP_000778528.1.87457 WP_000778528.1.87461 WP_000778528.1.87466 WP_000778528.1.875 WP_000778528.1.87508 WP_000778528.1.87515 WP_000778528.1.8753 WP_000778528.1.87543 WP_000778528.1.87710 WP_000778528.1.87718 WP_000778528.1.87748 WP_000778528.1.87764 WP_000778528.1.8779 WP_000778528.1.87808 WP_000778528.1.87828 WP_000778528.1.87879 WP_000778528.1.87912 WP_000778528.1.87963 WP_000778528.1.87972 WP_000778528.1.88013 WP_000778528.1.88032 WP_000778528.1.88061 WP_000778528.1.88114 WP_000778528.1.88150 WP_000778528.1.88270 WP_000778528.1.88319 WP_000778528.1.88351 WP_000778528.1.88367 WP_000778528.1.88380 WP_000778528.1.88480 WP_000778528.1.88498 WP_000778528.1.88518 WP_000778528.1.88558 WP_000778528.1.8857 WP_000778528.1.88580 WP_000778528.1.88599 WP_000778528.1.88623 WP_000778528.1.88636 WP_000778528.1.88642 WP_000778528.1.88671 WP_000778528.1.88694 WP_000778528.1.8872 WP_000778528.1.88739 WP_000778528.1.88856 WP_000778528.1.88859 WP_000778528.1.8888 WP_000778528.1.88922 WP_000778528.1.88934 WP_000778528.1.8900 WP_000778528.1.89086 WP_000778528.1.8913 WP_000778528.1.89181 WP_000778528.1.89194 WP_000778528.1.89195 WP_000778528.1.8924 WP_000778528.1.89258 WP_000778528.1.89284 WP_000778528.1.89537 WP_000778528.1.89544 WP_000778528.1.89545 WP_000778528.1.89559 WP_000778528.1.89655 WP_000778528.1.89672 WP_000778528.1.89678 WP_000778528.1.89726 WP_000778528.1.89730 WP_000778528.1.89754 WP_000778528.1.89883 WP_000778528.1.89935 WP_000778528.1.89960 WP_000778528.1.90005 WP_000778528.1.90018 WP_000778528.1.90046 WP_000778528.1.90055 WP_000778528.1.90091 WP_000778528.1.90131 WP_000778528.1.90148 WP_000778528.1.90161 WP_000778528.1.90180 WP_000778528.1.90215 WP_000778528.1.9022 WP_000778528.1.90243 WP_000778528.1.90253 WP_000778528.1.90276 WP_000778528.1.9030 WP_000778528.1.90331 WP_000778528.1.90367 WP_000778528.1.90473 WP_000778528.1.90544 WP_000778528.1.90604 WP_000778528.1.90647 WP_000778528.1.90660 WP_000778528.1.90683 WP_000778528.1.90726 WP_000778528.1.90728 WP_000778528.1.90738 WP_000778528.1.90745 WP_000778528.1.90801 WP_000778528.1.90804 WP_000778528.1.90861 WP_000778528.1.90896 WP_000778528.1.90903 WP_000778528.1.9100 WP_000778528.1.91011 WP_000778528.1.91126 WP_000778528.1.9114 WP_000778528.1.91158 WP_000778528.1.912 WP_000778528.1.91233 WP_000778528.1.91246 WP_000778528.1.91258 WP_000778528.1.91279 WP_000778528.1.91332 WP_000778528.1.91346 WP_000778528.1.91357 WP_000778528.1.91364 WP_000778528.1.91382 WP_000778528.1.9140 WP_000778528.1.91420 WP_000778528.1.91427 WP_000778528.1.91487 WP_000778528.1.91559 WP_000778528.1.91573 WP_000778528.1.91581 WP_000778528.1.91587 WP_000778528.1.91639 WP_000778528.1.91749 WP_000778528.1.91771 WP_000778528.1.91791 WP_000778528.1.91800 WP_000778528.1.91816 WP_000778528.1.91829 WP_000778528.1.91895 WP_000778528.1.91928 WP_000778528.1.91950 WP_000778528.1.92 WP_000778528.1.92133 WP_000778528.1.92140 WP_000778528.1.92164 WP_000778528.1.92169 WP_000778528.1.92185 WP_000778528.1.92196 WP_000778528.1.92227 WP_000778528.1.9224 WP_000778528.1.92253 WP_000778528.1.9239 WP_000778528.1.92436 WP_000778528.1.92442 WP_000778528.1.92497 WP_000778528.1.92500 WP_000778528.1.92520 WP_000778528.1.92534 WP_000778528.1.92607 WP_000778528.1.92691 WP_000778528.1.92723 WP_000778528.1.92735 WP_000778528.1.92741 WP_000778528.1.92773 WP_000778528.1.92789 WP_000778528.1.92805 WP_000778528.1.92862 WP_000778528.1.92864 WP_000778528.1.9293 WP_000778528.1.92950 WP_000778528.1.93125 WP_000778528.1.93163 WP_000778528.1.93176 WP_000778528.1.93191 WP_000778528.1.93300 WP_000778528.1.93336 WP_000778528.1.93416 WP_000778528.1.93438 WP_000778528.1.93444 WP_000778528.1.93514 WP_000778528.1.9352 WP_000778528.1.9354 WP_000778528.1.9358 WP_000778528.1.93590 WP_000778528.1.93658 WP_000778528.1.93678 WP_000778528.1.93710 WP_000778528.1.93722 WP_000778528.1.93738 WP_000778528.1.93769 WP_000778528.1.93787 WP_000778528.1.9387 WP_000778528.1.93882 WP_000778528.1.93883 WP_000778528.1.93891 WP_000778528.1.9398 WP_000778528.1.93981 WP_000778528.1.94074 WP_000778528.1.94082 WP_000778528.1.94087 WP_000778528.1.94096 WP_000778528.1.94165 WP_000778528.1.94172 WP_000778528.1.94293 WP_000778528.1.94294 WP_000778528.1.94335 WP_000778528.1.94340 WP_000778528.1.9437 WP_000778528.1.94374 WP_000778528.1.94375 WP_000778528.1.94376 WP_000778528.1.94414 WP_000778528.1.94530 WP_000778528.1.94550 WP_000778528.1.94576 WP_000778528.1.9464 WP_000778528.1.94688 WP_000778528.1.94733 WP_000778528.1.94741 WP_000778528.1.94789 WP_000778528.1.94797 WP_000778528.1.94844 WP_000778528.1.94845 WP_000778528.1.9485 WP_000778528.1.94857 WP_000778528.1.94866 WP_000778528.1.9497 WP_000778528.1.94980 WP_000778528.1.94999 WP_000778528.1.95038 WP_000778528.1.95077 WP_000778528.1.9510 WP_000778528.1.95120 WP_000778528.1.95327 WP_000778528.1.95342 WP_000778528.1.95361 WP_000778528.1.95372 WP_000778528.1.9538 WP_000778528.1.95537 WP_000778528.1.95581 WP_000778528.1.95603 WP_000778528.1.95639 WP_000778528.1.95681 WP_000778528.1.95699 WP_000778528.1.95704 WP_000778528.1.95713 WP_000778528.1.95714 WP_000778528.1.95737 WP_000778528.1.95760 WP_000778528.1.95806 WP_000778528.1.95877 WP_000778528.1.95885 WP_000778528.1.95918 WP_000778528.1.95986 WP_000778528.1.95997 WP_000778528.1.96014 WP_000778528.1.96030 WP_000778528.1.96056 WP_000778528.1.96057 WP_000778528.1.96067 WP_000778528.1.96075 WP_000778528.1.96135 WP_000778528.1.96148 WP_000778528.1.96228 WP_000778528.1.96255 WP_000778528.1.96283 WP_000778528.1.96297 WP_000778528.1.96312 WP_000778528.1.96314 WP_000778528.1.96322 WP_000778528.1.96334 WP_000778528.1.96362 WP_000778528.1.96433 WP_000778528.1.96472 WP_000778528.1.9650 WP_000778528.1.96535 WP_000778528.1.96538 WP_000778528.1.96554 WP_000778528.1.96566 WP_000778528.1.96591 WP_000778528.1.96603 WP_000778528.1.96678 WP_000778528.1.96699 WP_000778528.1.96705 WP_000778528.1.9675 WP_000778528.1.96780 WP_000778528.1.96836 WP_000778528.1.96855 WP_000778528.1.96859 WP_000778528.1.96922 WP_000778528.1.96965 WP_000778528.1.96969 WP_000778528.1.96985 WP_000778528.1.96997 WP_000778528.1.97000 WP_000778528.1.97014 WP_000778528.1.97034 WP_000778528.1.97141 WP_000778528.1.97161 WP_000778528.1.97164 WP_000778528.1.97205 WP_000778528.1.97228 WP_000778528.1.97230 WP_000778528.1.97241 WP_000778528.1.97312 WP_000778528.1.97348 WP_000778528.1.97355 WP_000778528.1.97367 WP_000778528.1.9737 WP_000778528.1.97392 WP_000778528.1.97427 WP_000778528.1.97450 WP_000778528.1.97456 WP_000778528.1.97494 WP_000778528.1.97530 WP_000778528.1.97531 WP_000778528.1.97537 WP_000778528.1.97576 WP_000778528.1.97585 WP_000778528.1.97664 WP_000778528.1.97687 WP_000778528.1.97696 WP_000778528.1.97699 WP_000778528.1.97744 WP_000778528.1.97746 WP_000778528.1.97762 WP_000778528.1.9788 WP_000778528.1.97935 WP_000778528.1.97955 WP_000778528.1.97974 WP_000778528.1.97997 WP_000778528.1.98054 WP_000778528.1.98058 WP_000778528.1.98073 WP_000778528.1.98161 WP_000778528.1.98174 WP_000778528.1.98179 WP_000778528.1.98195 WP_000778528.1.98233 WP_000778528.1.98248 WP_000778528.1.98249 WP_000778528.1.98281 WP_000778528.1.98295 WP_000778528.1.98328 WP_000778528.1.98352 WP_000778528.1.98366 WP_000778528.1.98387 WP_000778528.1.98409 WP_000778528.1.98425 WP_000778528.1.98585 WP_000778528.1.98609 WP_000778528.1.98659 WP_000778528.1.98667 WP_000778528.1.9872 WP_000778528.1.98723 WP_000778528.1.98730 WP_000778528.1.98734 WP_000778528.1.98741 WP_000778528.1.98750 WP_000778528.1.98786 WP_000778528.1.98797 WP_000778528.1.98821 WP_000778528.1.98842 WP_000778528.1.98880 WP_000778528.1.98883 WP_000778528.1.98985 WP_000778528.1.9910 WP_000778528.1.99136 WP_000778528.1.99207 WP_000778528.1.99283 WP_000778528.1.99308 WP_000778528.1.99414 WP_000778528.1.99418 WP_000778528.1.99509 WP_000778528.1.99523 WP_000778528.1.9965 WP_000778528.1.99683 WP_000778528.1.99830 WP_000778528.1.99849 WP_000778528.1.99859 WP_000778528.1.99884 WP_000778528.1.99954 WP_000778528.1.99955 WP_000778528.1.99984 WP_000778528.1.99999 158878.SAV1796 158879.SA1614 359786.SaurJH9_1846 359787.SaurJH1_1882 418127.SAHV_1781 gi|384865001|ref|YP_005750360.1| gi|15927370|ref|NP_374903.1| gi|150394336|ref|YP_001317011.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]