SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 359786.SaurJH9_2103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  359786.SaurJH9_2103
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.33e-24
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 359786.SaurJH9_2103
Sequence length 108
Comment (Staphylococcus aureus JH9)
Sequence
MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGL
GLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE
Download sequence
Identical sequences A0A0D1H3B9 A0A0E0VSI2 A0A0E1AKB7 A0A0E1VK92 A0A0E1X8N3 A0A0H2XG98 A0A0H3K9P0 A0A1E8WXA1 A0A2H5AQF5 G7ZQ76 P60070 P60071 P66837 P66838 P66839 Q6G7P3 Q6GF07 Q6XZ93 T1YA78
gi|15927641|ref|NP_375174.1| gi|387603344|ref|YP_005734865.1| gi|404479344|ref|YP_006710774.1| gi|384867015|ref|YP_005747211.1| gi|21283719|ref|NP_646807.1| gi|384548292|ref|YP_005737545.1| gi|379021743|ref|YP_005298405.1| gi|521212838|ref|YP_008169184.1| gi|537461779|ref|YP_008492219.1| gi|479330071|ref|YP_007869130.1| gi|545638291|ref|YP_008588467.1| WP_001052491.1.100013 WP_001052491.1.100028 WP_001052491.1.100041 WP_001052491.1.100049 WP_001052491.1.100057 WP_001052491.1.10006 WP_001052491.1.100067 WP_001052491.1.100072 WP_001052491.1.100075 WP_001052491.1.100084 WP_001052491.1.100088 WP_001052491.1.100090 WP_001052491.1.100094 WP_001052491.1.100096 WP_001052491.1.100117 WP_001052491.1.100122 WP_001052491.1.10014 WP_001052491.1.100154 WP_001052491.1.100171 WP_001052491.1.100180 WP_001052491.1.100184 WP_001052491.1.100189 WP_001052491.1.100235 WP_001052491.1.100265 WP_001052491.1.100272 WP_001052491.1.100298 WP_001052491.1.100307 WP_001052491.1.100310 WP_001052491.1.100335 WP_001052491.1.100347 WP_001052491.1.100352 WP_001052491.1.100357 WP_001052491.1.100366 WP_001052491.1.100384 WP_001052491.1.100391 WP_001052491.1.100399 WP_001052491.1.10041 WP_001052491.1.100452 WP_001052491.1.10046 WP_001052491.1.100464 WP_001052491.1.10050 WP_001052491.1.100507 WP_001052491.1.100527 WP_001052491.1.10053 WP_001052491.1.100534 WP_001052491.1.100535 WP_001052491.1.100551 WP_001052491.1.100560 WP_001052491.1.100561 WP_001052491.1.100562 WP_001052491.1.100582 WP_001052491.1.100596 WP_001052491.1.100604 WP_001052491.1.100612 WP_001052491.1.100613 WP_001052491.1.100618 WP_001052491.1.100631 WP_001052491.1.100647 WP_001052491.1.100665 WP_001052491.1.100668 WP_001052491.1.100678 WP_001052491.1.100693 WP_001052491.1.100699 WP_001052491.1.100704 WP_001052491.1.100719 WP_001052491.1.100726 WP_001052491.1.100761 WP_001052491.1.100768 WP_001052491.1.100785 WP_001052491.1.100823 WP_001052491.1.100832 WP_001052491.1.100834 WP_001052491.1.10085 WP_001052491.1.100860 WP_001052491.1.100888 WP_001052491.1.1009 WP_001052491.1.100903 WP_001052491.1.100920 WP_001052491.1.100922 WP_001052491.1.100934 WP_001052491.1.100956 WP_001052491.1.100963 WP_001052491.1.10097 WP_001052491.1.100981 WP_001052491.1.100986 WP_001052491.1.100987 WP_001052491.1.101002 WP_001052491.1.101015 WP_001052491.1.101017 WP_001052491.1.101019 WP_001052491.1.101023 WP_001052491.1.101027 WP_001052491.1.101055 WP_001052491.1.101058 WP_001052491.1.101068 WP_001052491.1.101071 WP_001052491.1.101072 WP_001052491.1.101084 WP_001052491.1.101103 WP_001052491.1.10111 WP_001052491.1.101142 WP_001052491.1.101160 WP_001052491.1.101177 WP_001052491.1.101192 WP_001052491.1.101217 WP_001052491.1.101240 WP_001052491.1.101262 WP_001052491.1.101266 WP_001052491.1.101298 WP_001052491.1.101327 WP_001052491.1.101329 WP_001052491.1.101330 WP_001052491.1.101352 WP_001052491.1.101355 WP_001052491.1.101375 WP_001052491.1.101379 WP_001052491.1.101393 WP_001052491.1.101397 WP_001052491.1.101402 WP_001052491.1.101406 WP_001052491.1.101414 WP_001052491.1.101441 WP_001052491.1.101458 WP_001052491.1.10148 WP_001052491.1.101490 WP_001052491.1.101495 WP_001052491.1.1015 WP_001052491.1.101505 WP_001052491.1.101511 WP_001052491.1.101531 WP_001052491.1.101566 WP_001052491.1.101567 WP_001052491.1.101570 WP_001052491.1.101598 WP_001052491.1.101615 WP_001052491.1.101617 WP_001052491.1.101619 WP_001052491.1.101627 WP_001052491.1.101645 WP_001052491.1.10165 WP_001052491.1.101657 WP_001052491.1.10166 WP_001052491.1.101661 WP_001052491.1.101670 WP_001052491.1.101691 WP_001052491.1.101704 WP_001052491.1.101716 WP_001052491.1.101725 WP_001052491.1.101728 WP_001052491.1.101731 WP_001052491.1.101745 WP_001052491.1.101757 WP_001052491.1.101758 WP_001052491.1.101775 WP_001052491.1.101778 WP_001052491.1.101779 WP_001052491.1.10178 WP_001052491.1.101788 WP_001052491.1.101813 WP_001052491.1.101820 WP_001052491.1.101821 WP_001052491.1.101824 WP_001052491.1.101825 WP_001052491.1.101831 WP_001052491.1.101852 WP_001052491.1.101902 WP_001052491.1.101906 WP_001052491.1.101921 WP_001052491.1.101922 WP_001052491.1.101943 WP_001052491.1.101950 WP_001052491.1.101999 WP_001052491.1.102065 WP_001052491.1.102066 WP_001052491.1.102070 WP_001052491.1.102084 WP_001052491.1.10209 WP_001052491.1.102096 WP_001052491.1.102123 WP_001052491.1.102126 WP_001052491.1.102130 WP_001052491.1.102132 WP_001052491.1.10214 WP_001052491.1.1022 WP_001052491.1.10232 WP_001052491.1.10238 WP_001052491.1.10240 WP_001052491.1.10244 WP_001052491.1.10249 WP_001052491.1.1025 WP_001052491.1.10274 WP_001052491.1.10292 WP_001052491.1.10294 WP_001052491.1.10301 WP_001052491.1.10306 WP_001052491.1.10308 WP_001052491.1.1031 WP_001052491.1.1032 WP_001052491.1.10321 WP_001052491.1.10340 WP_001052491.1.10343 WP_001052491.1.10355 WP_001052491.1.10358 WP_001052491.1.10397 WP_001052491.1.10408 WP_001052491.1.1043 WP_001052491.1.10431 WP_001052491.1.10436 WP_001052491.1.10450 WP_001052491.1.10469 WP_001052491.1.10478 WP_001052491.1.10481 WP_001052491.1.10486 WP_001052491.1.10503 WP_001052491.1.1052 WP_001052491.1.10526 WP_001052491.1.10542 WP_001052491.1.10543 WP_001052491.1.10565 WP_001052491.1.10583 WP_001052491.1.1060 WP_001052491.1.10614 WP_001052491.1.10617 WP_001052491.1.10624 WP_001052491.1.10644 WP_001052491.1.10664 WP_001052491.1.10679 WP_001052491.1.10707 WP_001052491.1.10726 WP_001052491.1.10742 WP_001052491.1.10749 WP_001052491.1.10751 WP_001052491.1.1077 WP_001052491.1.10783 WP_001052491.1.10785 WP_001052491.1.10823 WP_001052491.1.10841 WP_001052491.1.10843 WP_001052491.1.10858 WP_001052491.1.1087 WP_001052491.1.10917 WP_001052491.1.10919 WP_001052491.1.10928 WP_001052491.1.10942 WP_001052491.1.10950 WP_001052491.1.10965 WP_001052491.1.10969 WP_001052491.1.1097 WP_001052491.1.10976 WP_001052491.1.10979 WP_001052491.1.10985 WP_001052491.1.10986 WP_001052491.1.11001 WP_001052491.1.11067 WP_001052491.1.11069 WP_001052491.1.11073 WP_001052491.1.11074 WP_001052491.1.11076 WP_001052491.1.11080 WP_001052491.1.11083 WP_001052491.1.11084 WP_001052491.1.11129 WP_001052491.1.1115 WP_001052491.1.11162 WP_001052491.1.11184 WP_001052491.1.11188 WP_001052491.1.1120 WP_001052491.1.11202 WP_001052491.1.11220 WP_001052491.1.11223 WP_001052491.1.11228 WP_001052491.1.11234 WP_001052491.1.1124 WP_001052491.1.11261 WP_001052491.1.11281 WP_001052491.1.11282 WP_001052491.1.11286 WP_001052491.1.11294 WP_001052491.1.11312 WP_001052491.1.11322 WP_001052491.1.11333 WP_001052491.1.11348 WP_001052491.1.11353 WP_001052491.1.1136 WP_001052491.1.11365 WP_001052491.1.11377 WP_001052491.1.11378 WP_001052491.1.11391 WP_001052491.1.11403 WP_001052491.1.11407 WP_001052491.1.11434 WP_001052491.1.11441 WP_001052491.1.11447 WP_001052491.1.11451 WP_001052491.1.11463 WP_001052491.1.1147 WP_001052491.1.11475 WP_001052491.1.11488 WP_001052491.1.11492 WP_001052491.1.11494 WP_001052491.1.11504 WP_001052491.1.1151 WP_001052491.1.11513 WP_001052491.1.1152 WP_001052491.1.11525 WP_001052491.1.11540 WP_001052491.1.11556 WP_001052491.1.11558 WP_001052491.1.11571 WP_001052491.1.11580 WP_001052491.1.11592 WP_001052491.1.11611 WP_001052491.1.11625 WP_001052491.1.11640 WP_001052491.1.11646 WP_001052491.1.11655 WP_001052491.1.11660 WP_001052491.1.11663 WP_001052491.1.11665 WP_001052491.1.11692 WP_001052491.1.117 WP_001052491.1.1171 WP_001052491.1.11719 WP_001052491.1.11720 WP_001052491.1.11723 WP_001052491.1.11730 WP_001052491.1.11736 WP_001052491.1.11741 WP_001052491.1.11768 WP_001052491.1.11781 WP_001052491.1.11794 WP_001052491.1.11795 WP_001052491.1.11816 WP_001052491.1.11828 WP_001052491.1.11829 WP_001052491.1.11837 WP_001052491.1.11884 WP_001052491.1.11894 WP_001052491.1.11903 WP_001052491.1.11904 WP_001052491.1.11919 WP_001052491.1.11969 WP_001052491.1.11991 WP_001052491.1.12005 WP_001052491.1.12019 WP_001052491.1.12026 WP_001052491.1.12029 WP_001052491.1.12042 WP_001052491.1.1205 WP_001052491.1.12073 WP_001052491.1.12098 WP_001052491.1.1210 WP_001052491.1.12123 WP_001052491.1.1213 WP_001052491.1.12137 WP_001052491.1.12149 WP_001052491.1.12152 WP_001052491.1.12158 WP_001052491.1.12170 WP_001052491.1.12179 WP_001052491.1.12181 WP_001052491.1.12193 WP_001052491.1.12194 WP_001052491.1.12201 WP_001052491.1.12226 WP_001052491.1.12233 WP_001052491.1.12234 WP_001052491.1.12256 WP_001052491.1.12272 WP_001052491.1.12297 WP_001052491.1.12328 WP_001052491.1.12330 WP_001052491.1.12353 WP_001052491.1.12361 WP_001052491.1.12366 WP_001052491.1.12436 WP_001052491.1.12437 WP_001052491.1.12447 WP_001052491.1.12498 WP_001052491.1.12508 WP_001052491.1.12516 WP_001052491.1.1252 WP_001052491.1.1253 WP_001052491.1.12555 WP_001052491.1.1257 WP_001052491.1.12597 WP_001052491.1.12598 WP_001052491.1.12605 WP_001052491.1.12608 WP_001052491.1.12618 WP_001052491.1.12639 WP_001052491.1.12668 WP_001052491.1.12685 WP_001052491.1.12705 WP_001052491.1.12707 WP_001052491.1.12711 WP_001052491.1.12715 WP_001052491.1.12733 WP_001052491.1.12737 WP_001052491.1.1276 WP_001052491.1.12770 WP_001052491.1.12771 WP_001052491.1.12772 WP_001052491.1.12780 WP_001052491.1.12788 WP_001052491.1.12802 WP_001052491.1.12822 WP_001052491.1.12829 WP_001052491.1.12833 WP_001052491.1.12845 WP_001052491.1.12858 WP_001052491.1.12862 WP_001052491.1.12884 WP_001052491.1.12886 WP_001052491.1.12903 WP_001052491.1.12904 WP_001052491.1.12918 WP_001052491.1.12920 WP_001052491.1.12937 WP_001052491.1.12938 WP_001052491.1.12951 WP_001052491.1.12977 WP_001052491.1.13013 WP_001052491.1.13039 WP_001052491.1.13062 WP_001052491.1.13072 WP_001052491.1.13091 WP_001052491.1.13104 WP_001052491.1.13112 WP_001052491.1.13154 WP_001052491.1.13164 WP_001052491.1.13169 WP_001052491.1.13170 WP_001052491.1.13189 WP_001052491.1.13228 WP_001052491.1.13241 WP_001052491.1.13243 WP_001052491.1.13250 WP_001052491.1.13303 WP_001052491.1.13307 WP_001052491.1.13317 WP_001052491.1.13322 WP_001052491.1.13326 WP_001052491.1.13336 WP_001052491.1.13355 WP_001052491.1.13366 WP_001052491.1.13376 WP_001052491.1.13379 WP_001052491.1.13381 WP_001052491.1.13405 WP_001052491.1.13448 WP_001052491.1.13468 WP_001052491.1.1347 WP_001052491.1.13486 WP_001052491.1.13501 WP_001052491.1.13505 WP_001052491.1.13514 WP_001052491.1.13531 WP_001052491.1.13532 WP_001052491.1.1355 WP_001052491.1.13554 WP_001052491.1.13556 WP_001052491.1.13557 WP_001052491.1.13568 WP_001052491.1.13598 WP_001052491.1.13612 WP_001052491.1.13617 WP_001052491.1.13650 WP_001052491.1.13654 WP_001052491.1.13665 WP_001052491.1.13668 WP_001052491.1.13670 WP_001052491.1.13679 WP_001052491.1.13680 WP_001052491.1.13683 WP_001052491.1.13696 WP_001052491.1.13709 WP_001052491.1.13726 WP_001052491.1.13727 WP_001052491.1.13728 WP_001052491.1.13733 WP_001052491.1.13734 WP_001052491.1.1374 WP_001052491.1.1375 WP_001052491.1.13755 WP_001052491.1.13757 WP_001052491.1.13769 WP_001052491.1.13772 WP_001052491.1.13804 WP_001052491.1.13805 WP_001052491.1.13807 WP_001052491.1.13831 WP_001052491.1.13870 WP_001052491.1.13879 WP_001052491.1.13884 WP_001052491.1.13897 WP_001052491.1.13904 WP_001052491.1.13914 WP_001052491.1.13933 WP_001052491.1.13940 WP_001052491.1.13947 WP_001052491.1.13948 WP_001052491.1.13983 WP_001052491.1.13986 WP_001052491.1.13987 WP_001052491.1.14010 WP_001052491.1.14025 WP_001052491.1.14034 WP_001052491.1.14071 WP_001052491.1.14076 WP_001052491.1.14097 WP_001052491.1.14112 WP_001052491.1.14143 WP_001052491.1.14153 WP_001052491.1.14163 WP_001052491.1.1418 WP_001052491.1.14192 WP_001052491.1.1420 WP_001052491.1.14201 WP_001052491.1.14221 WP_001052491.1.14233 WP_001052491.1.1425 WP_001052491.1.1426 WP_001052491.1.14272 WP_001052491.1.1429 WP_001052491.1.14298 WP_001052491.1.14302 WP_001052491.1.14305 WP_001052491.1.14314 WP_001052491.1.14337 WP_001052491.1.14342 WP_001052491.1.14349 WP_001052491.1.14355 WP_001052491.1.14358 WP_001052491.1.14363 WP_001052491.1.14364 WP_001052491.1.14365 WP_001052491.1.14366 WP_001052491.1.14372 WP_001052491.1.14394 WP_001052491.1.14397 WP_001052491.1.14412 WP_001052491.1.14418 WP_001052491.1.14475 WP_001052491.1.14535 WP_001052491.1.14546 WP_001052491.1.1457 WP_001052491.1.14577 WP_001052491.1.14590 WP_001052491.1.14596 WP_001052491.1.14639 WP_001052491.1.14665 WP_001052491.1.14666 WP_001052491.1.1468 WP_001052491.1.14681 WP_001052491.1.14696 WP_001052491.1.147 WP_001052491.1.1471 WP_001052491.1.14729 WP_001052491.1.14734 WP_001052491.1.14744 WP_001052491.1.14747 WP_001052491.1.1477 WP_001052491.1.14770 WP_001052491.1.14774 WP_001052491.1.14782 WP_001052491.1.14787 WP_001052491.1.14790 WP_001052491.1.14809 WP_001052491.1.14823 WP_001052491.1.14825 WP_001052491.1.14845 WP_001052491.1.14846 WP_001052491.1.14866 WP_001052491.1.14868 WP_001052491.1.14869 WP_001052491.1.14874 WP_001052491.1.14888 WP_001052491.1.1490 WP_001052491.1.14902 WP_001052491.1.14924 WP_001052491.1.14925 WP_001052491.1.14967 WP_001052491.1.14970 WP_001052491.1.14987 WP_001052491.1.15000 WP_001052491.1.15015 WP_001052491.1.15022 WP_001052491.1.15029 WP_001052491.1.15039 WP_001052491.1.15071 WP_001052491.1.15091 WP_001052491.1.15098 WP_001052491.1.15108 WP_001052491.1.15150 WP_001052491.1.15173 WP_001052491.1.15182 WP_001052491.1.15185 WP_001052491.1.1520 WP_001052491.1.15201 WP_001052491.1.15206 WP_001052491.1.15228 WP_001052491.1.15234 WP_001052491.1.15241 WP_001052491.1.1525 WP_001052491.1.15255 WP_001052491.1.15263 WP_001052491.1.15268 WP_001052491.1.15269 WP_001052491.1.15278 WP_001052491.1.15294 WP_001052491.1.15296 WP_001052491.1.15329 WP_001052491.1.15389 WP_001052491.1.15399 WP_001052491.1.15403 WP_001052491.1.15409 WP_001052491.1.15421 WP_001052491.1.15438 WP_001052491.1.1545 WP_001052491.1.15478 WP_001052491.1.15489 WP_001052491.1.15505 WP_001052491.1.15507 WP_001052491.1.15519 WP_001052491.1.15524 WP_001052491.1.15532 WP_001052491.1.15533 WP_001052491.1.15544 WP_001052491.1.15546 WP_001052491.1.15554 WP_001052491.1.15572 WP_001052491.1.1558 WP_001052491.1.15590 WP_001052491.1.15591 WP_001052491.1.15601 WP_001052491.1.1562 WP_001052491.1.1564 WP_001052491.1.15641 WP_001052491.1.15679 WP_001052491.1.15685 WP_001052491.1.15687 WP_001052491.1.1569 WP_001052491.1.15691 WP_001052491.1.15706 WP_001052491.1.15712 WP_001052491.1.15722 WP_001052491.1.15753 WP_001052491.1.15785 WP_001052491.1.1579 WP_001052491.1.15812 WP_001052491.1.15818 WP_001052491.1.15819 WP_001052491.1.1583 WP_001052491.1.15838 WP_001052491.1.15858 WP_001052491.1.1586 WP_001052491.1.15883 WP_001052491.1.15888 WP_001052491.1.15892 WP_001052491.1.15897 WP_001052491.1.15898 WP_001052491.1.159 WP_001052491.1.15920 WP_001052491.1.15921 WP_001052491.1.15925 WP_001052491.1.15928 WP_001052491.1.15939 WP_001052491.1.15948 WP_001052491.1.15957 WP_001052491.1.15972 WP_001052491.1.1599 WP_001052491.1.1600 WP_001052491.1.16018 WP_001052491.1.16026 WP_001052491.1.1606 WP_001052491.1.16068 WP_001052491.1.16079 WP_001052491.1.16083 WP_001052491.1.16095 WP_001052491.1.16096 WP_001052491.1.16098 WP_001052491.1.16112 WP_001052491.1.16114 WP_001052491.1.16140 WP_001052491.1.16157 WP_001052491.1.16173 WP_001052491.1.16195 WP_001052491.1.16203 WP_001052491.1.16213 WP_001052491.1.16214 WP_001052491.1.16223 WP_001052491.1.1623 WP_001052491.1.16237 WP_001052491.1.16251 WP_001052491.1.16265 WP_001052491.1.16276 WP_001052491.1.16283 WP_001052491.1.16311 WP_001052491.1.16362 WP_001052491.1.16372 WP_001052491.1.16395 WP_001052491.1.16399 WP_001052491.1.16407 WP_001052491.1.16408 WP_001052491.1.16414 WP_001052491.1.16417 WP_001052491.1.16433 WP_001052491.1.16436 WP_001052491.1.16455 WP_001052491.1.16458 WP_001052491.1.16467 WP_001052491.1.16471 WP_001052491.1.16478 WP_001052491.1.16554 WP_001052491.1.16564 WP_001052491.1.16569 WP_001052491.1.16589 WP_001052491.1.16603 WP_001052491.1.16606 WP_001052491.1.16617 WP_001052491.1.1662 WP_001052491.1.16628 WP_001052491.1.16632 WP_001052491.1.16649 WP_001052491.1.1665 WP_001052491.1.16651 WP_001052491.1.16653 WP_001052491.1.16664 WP_001052491.1.16672 WP_001052491.1.16679 WP_001052491.1.16684 WP_001052491.1.16688 WP_001052491.1.16693 WP_001052491.1.16703 WP_001052491.1.16747 WP_001052491.1.16757 WP_001052491.1.16761 WP_001052491.1.16762 WP_001052491.1.16768 WP_001052491.1.16770 WP_001052491.1.16776 WP_001052491.1.16794 WP_001052491.1.16802 WP_001052491.1.16815 WP_001052491.1.16824 WP_001052491.1.16833 WP_001052491.1.16880 WP_001052491.1.16882 WP_001052491.1.16892 WP_001052491.1.16920 WP_001052491.1.16925 WP_001052491.1.16936 WP_001052491.1.16938 WP_001052491.1.16946 WP_001052491.1.16969 WP_001052491.1.16986 WP_001052491.1.17009 WP_001052491.1.17012 WP_001052491.1.17038 WP_001052491.1.17046 WP_001052491.1.17050 WP_001052491.1.17080 WP_001052491.1.17104 WP_001052491.1.17122 WP_001052491.1.17132 WP_001052491.1.17137 WP_001052491.1.17139 WP_001052491.1.17143 WP_001052491.1.17156 WP_001052491.1.17157 WP_001052491.1.17169 WP_001052491.1.17176 WP_001052491.1.17193 WP_001052491.1.17200 WP_001052491.1.17201 WP_001052491.1.17210 WP_001052491.1.17231 WP_001052491.1.17234 WP_001052491.1.17240 WP_001052491.1.17248 WP_001052491.1.17249 WP_001052491.1.1725 WP_001052491.1.17256 WP_001052491.1.17289 WP_001052491.1.1729 WP_001052491.1.17296 WP_001052491.1.17309 WP_001052491.1.17320 WP_001052491.1.17327 WP_001052491.1.1736 WP_001052491.1.1740 WP_001052491.1.1741 WP_001052491.1.17419 WP_001052491.1.17450 WP_001052491.1.17454 WP_001052491.1.17456 WP_001052491.1.17475 WP_001052491.1.17485 WP_001052491.1.1751 WP_001052491.1.17520 WP_001052491.1.17524 WP_001052491.1.17526 WP_001052491.1.17529 WP_001052491.1.17531 WP_001052491.1.1756 WP_001052491.1.17569 WP_001052491.1.17581 WP_001052491.1.17590 WP_001052491.1.17628 WP_001052491.1.17640 WP_001052491.1.17643 WP_001052491.1.1765 WP_001052491.1.17650 WP_001052491.1.17651 WP_001052491.1.17657 WP_001052491.1.17658 WP_001052491.1.17666 WP_001052491.1.17671 WP_001052491.1.17676 WP_001052491.1.1771 WP_001052491.1.17717 WP_001052491.1.17718 WP_001052491.1.17720 WP_001052491.1.17725 WP_001052491.1.17729 WP_001052491.1.17737 WP_001052491.1.17770 WP_001052491.1.17796 WP_001052491.1.17817 WP_001052491.1.17818 WP_001052491.1.17832 WP_001052491.1.17834 WP_001052491.1.17835 WP_001052491.1.17838 WP_001052491.1.17845 WP_001052491.1.17847 WP_001052491.1.17853 WP_001052491.1.17859 WP_001052491.1.1787 WP_001052491.1.17876 WP_001052491.1.17882 WP_001052491.1.17909 WP_001052491.1.17922 WP_001052491.1.17928 WP_001052491.1.17929 WP_001052491.1.17943 WP_001052491.1.17951 WP_001052491.1.17966 WP_001052491.1.17974 WP_001052491.1.17987 WP_001052491.1.18011 WP_001052491.1.18016 WP_001052491.1.18035 WP_001052491.1.18043 WP_001052491.1.18069 WP_001052491.1.18074 WP_001052491.1.18080 WP_001052491.1.18105 WP_001052491.1.1811 WP_001052491.1.18113 WP_001052491.1.18132 WP_001052491.1.18140 WP_001052491.1.18153 WP_001052491.1.18197 WP_001052491.1.18203 WP_001052491.1.18205 WP_001052491.1.18237 WP_001052491.1.18248 WP_001052491.1.18261 WP_001052491.1.18273 WP_001052491.1.18283 WP_001052491.1.18288 WP_001052491.1.1829 WP_001052491.1.18290 WP_001052491.1.18301 WP_001052491.1.18309 WP_001052491.1.18310 WP_001052491.1.18320 WP_001052491.1.18346 WP_001052491.1.1835 WP_001052491.1.18360 WP_001052491.1.18412 WP_001052491.1.18424 WP_001052491.1.18429 WP_001052491.1.18437 WP_001052491.1.18451 WP_001052491.1.18466 WP_001052491.1.1847 WP_001052491.1.18487 WP_001052491.1.1849 WP_001052491.1.18495 WP_001052491.1.18497 WP_001052491.1.185 WP_001052491.1.18504 WP_001052491.1.18506 WP_001052491.1.18507 WP_001052491.1.1851 WP_001052491.1.18516 WP_001052491.1.18526 WP_001052491.1.18527 WP_001052491.1.18529 WP_001052491.1.18538 WP_001052491.1.18539 WP_001052491.1.18545 WP_001052491.1.18560 WP_001052491.1.18562 WP_001052491.1.18566 WP_001052491.1.18567 WP_001052491.1.18570 WP_001052491.1.18590 WP_001052491.1.18591 WP_001052491.1.18605 WP_001052491.1.18611 WP_001052491.1.18627 WP_001052491.1.18632 WP_001052491.1.18656 WP_001052491.1.18658 WP_001052491.1.18668 WP_001052491.1.18679 WP_001052491.1.18719 WP_001052491.1.18741 WP_001052491.1.18758 WP_001052491.1.18763 WP_001052491.1.18774 WP_001052491.1.18777 WP_001052491.1.18779 WP_001052491.1.18792 WP_001052491.1.18799 WP_001052491.1.18809 WP_001052491.1.18818 WP_001052491.1.18819 WP_001052491.1.18830 WP_001052491.1.18834 WP_001052491.1.18836 WP_001052491.1.18870 WP_001052491.1.18879 WP_001052491.1.18882 WP_001052491.1.18918 WP_001052491.1.1892 WP_001052491.1.18938 WP_001052491.1.18963 WP_001052491.1.18965 WP_001052491.1.18968 WP_001052491.1.18974 WP_001052491.1.18987 WP_001052491.1.18996 WP_001052491.1.19009 WP_001052491.1.1901 WP_001052491.1.19014 WP_001052491.1.19022 WP_001052491.1.19027 WP_001052491.1.19052 WP_001052491.1.19082 WP_001052491.1.19102 WP_001052491.1.19109 WP_001052491.1.1911 WP_001052491.1.1912 WP_001052491.1.19149 WP_001052491.1.19179 WP_001052491.1.192 WP_001052491.1.1921 WP_001052491.1.19259 WP_001052491.1.19272 WP_001052491.1.19301 WP_001052491.1.19306 WP_001052491.1.19322 WP_001052491.1.19365 WP_001052491.1.19370 WP_001052491.1.19375 WP_001052491.1.19377 WP_001052491.1.19386 WP_001052491.1.19390 WP_001052491.1.19399 WP_001052491.1.1940 WP_001052491.1.19411 WP_001052491.1.1943 WP_001052491.1.19430 WP_001052491.1.19444 WP_001052491.1.19450 WP_001052491.1.19455 WP_001052491.1.19497 WP_001052491.1.19509 WP_001052491.1.19515 WP_001052491.1.19537 WP_001052491.1.19555 WP_001052491.1.19575 WP_001052491.1.19577 WP_001052491.1.19611 WP_001052491.1.1962 WP_001052491.1.1964 WP_001052491.1.19643 WP_001052491.1.19653 WP_001052491.1.19700 WP_001052491.1.19701 WP_001052491.1.19717 WP_001052491.1.19725 WP_001052491.1.19732 WP_001052491.1.19733 WP_001052491.1.1974 WP_001052491.1.19748 WP_001052491.1.1975 WP_001052491.1.19759 WP_001052491.1.19765 WP_001052491.1.19775 WP_001052491.1.19788 WP_001052491.1.19792 WP_001052491.1.19801 WP_001052491.1.19807 WP_001052491.1.19816 WP_001052491.1.19848 WP_001052491.1.19853 WP_001052491.1.19881 WP_001052491.1.19891 WP_001052491.1.19905 WP_001052491.1.19912 WP_001052491.1.19921 WP_001052491.1.19968 WP_001052491.1.19974 WP_001052491.1.19977 WP_001052491.1.19980 WP_001052491.1.19981 WP_001052491.1.19982 WP_001052491.1.2 WP_001052491.1.20006 WP_001052491.1.20049 WP_001052491.1.20052 WP_001052491.1.20057 WP_001052491.1.2007 WP_001052491.1.20078 WP_001052491.1.2008 WP_001052491.1.20090 WP_001052491.1.20100 WP_001052491.1.20101 WP_001052491.1.2013 WP_001052491.1.20155 WP_001052491.1.20156 WP_001052491.1.20160 WP_001052491.1.20161 WP_001052491.1.20167 WP_001052491.1.20177 WP_001052491.1.20191 WP_001052491.1.20201 WP_001052491.1.20210 WP_001052491.1.20214 WP_001052491.1.20219 WP_001052491.1.20221 WP_001052491.1.20235 WP_001052491.1.20245 WP_001052491.1.2025 WP_001052491.1.20265 WP_001052491.1.2029 WP_001052491.1.20307 WP_001052491.1.20324 WP_001052491.1.20340 WP_001052491.1.20354 WP_001052491.1.20358 WP_001052491.1.20386 WP_001052491.1.20394 WP_001052491.1.20398 WP_001052491.1.20399 WP_001052491.1.20411 WP_001052491.1.20447 WP_001052491.1.20473 WP_001052491.1.20479 WP_001052491.1.20487 WP_001052491.1.20496 WP_001052491.1.20500 WP_001052491.1.20512 WP_001052491.1.20550 WP_001052491.1.20554 WP_001052491.1.20558 WP_001052491.1.2056 WP_001052491.1.20574 WP_001052491.1.20579 WP_001052491.1.20585 WP_001052491.1.20598 WP_001052491.1.20611 WP_001052491.1.20618 WP_001052491.1.20619 WP_001052491.1.20620 WP_001052491.1.20649 WP_001052491.1.20661 WP_001052491.1.20690 WP_001052491.1.20698 WP_001052491.1.20736 WP_001052491.1.20772 WP_001052491.1.2079 WP_001052491.1.20796 WP_001052491.1.20821 WP_001052491.1.20833 WP_001052491.1.20838 WP_001052491.1.20846 WP_001052491.1.20860 WP_001052491.1.20866 WP_001052491.1.20867 WP_001052491.1.20878 WP_001052491.1.20906 WP_001052491.1.20913 WP_001052491.1.20922 WP_001052491.1.20935 WP_001052491.1.20945 WP_001052491.1.20971 WP_001052491.1.20975 WP_001052491.1.20979 WP_001052491.1.21009 WP_001052491.1.21013 WP_001052491.1.21015 WP_001052491.1.21031 WP_001052491.1.21036 WP_001052491.1.21054 WP_001052491.1.21056 WP_001052491.1.21064 WP_001052491.1.21066 WP_001052491.1.21078 WP_001052491.1.21080 WP_001052491.1.21081 WP_001052491.1.21102 WP_001052491.1.21109 WP_001052491.1.21111 WP_001052491.1.21140 WP_001052491.1.21154 WP_001052491.1.21183 WP_001052491.1.2119 WP_001052491.1.21222 WP_001052491.1.21257 WP_001052491.1.21259 WP_001052491.1.21272 WP_001052491.1.2128 WP_001052491.1.2129 WP_001052491.1.21312 WP_001052491.1.21313 WP_001052491.1.21314 WP_001052491.1.21330 WP_001052491.1.21339 WP_001052491.1.2135 WP_001052491.1.21356 WP_001052491.1.21359 WP_001052491.1.21375 WP_001052491.1.21379 WP_001052491.1.21386 WP_001052491.1.21393 WP_001052491.1.21402 WP_001052491.1.21412 WP_001052491.1.21416 WP_001052491.1.21449 WP_001052491.1.21458 WP_001052491.1.21464 WP_001052491.1.21465 WP_001052491.1.21477 WP_001052491.1.21480 WP_001052491.1.21500 WP_001052491.1.21505 WP_001052491.1.21511 WP_001052491.1.21514 WP_001052491.1.21536 WP_001052491.1.2154 WP_001052491.1.21572 WP_001052491.1.21583 WP_001052491.1.21589 WP_001052491.1.2159 WP_001052491.1.2160 WP_001052491.1.21621 WP_001052491.1.21636 WP_001052491.1.21679 WP_001052491.1.21712 WP_001052491.1.21719 WP_001052491.1.21724 WP_001052491.1.21746 WP_001052491.1.21763 WP_001052491.1.2178 WP_001052491.1.21787 WP_001052491.1.21820 WP_001052491.1.21828 WP_001052491.1.21830 WP_001052491.1.21890 WP_001052491.1.21894 WP_001052491.1.21900 WP_001052491.1.21901 WP_001052491.1.21919 WP_001052491.1.21954 WP_001052491.1.21985 WP_001052491.1.21988 WP_001052491.1.2200 WP_001052491.1.22000 WP_001052491.1.22011 WP_001052491.1.22022 WP_001052491.1.22027 WP_001052491.1.22033 WP_001052491.1.22038 WP_001052491.1.22045 WP_001052491.1.22049 WP_001052491.1.22065 WP_001052491.1.22082 WP_001052491.1.22093 WP_001052491.1.2211 WP_001052491.1.22111 WP_001052491.1.22149 WP_001052491.1.22163 WP_001052491.1.22164 WP_001052491.1.22165 WP_001052491.1.22170 WP_001052491.1.22174 WP_001052491.1.22177 WP_001052491.1.22180 WP_001052491.1.22197 WP_001052491.1.22200 WP_001052491.1.22227 WP_001052491.1.22246 WP_001052491.1.22259 WP_001052491.1.22300 WP_001052491.1.22302 WP_001052491.1.22307 WP_001052491.1.22332 WP_001052491.1.22344 WP_001052491.1.22345 WP_001052491.1.22351 WP_001052491.1.22367 WP_001052491.1.22369 WP_001052491.1.22400 WP_001052491.1.22418 WP_001052491.1.22419 WP_001052491.1.22426 WP_001052491.1.22441 WP_001052491.1.22493 WP_001052491.1.22498 WP_001052491.1.22512 WP_001052491.1.22531 WP_001052491.1.22533 WP_001052491.1.22547 WP_001052491.1.22551 WP_001052491.1.22559 WP_001052491.1.22650 WP_001052491.1.22657 WP_001052491.1.22684 WP_001052491.1.22696 WP_001052491.1.22702 WP_001052491.1.22709 WP_001052491.1.22714 WP_001052491.1.22727 WP_001052491.1.22730 WP_001052491.1.22731 WP_001052491.1.22738 WP_001052491.1.22739 WP_001052491.1.22764 WP_001052491.1.22787 WP_001052491.1.22789 WP_001052491.1.22790 WP_001052491.1.22792 WP_001052491.1.2280 WP_001052491.1.22803 WP_001052491.1.22808 WP_001052491.1.22811 WP_001052491.1.22826 WP_001052491.1.22843 WP_001052491.1.22853 WP_001052491.1.22859 WP_001052491.1.22861 WP_001052491.1.22869 WP_001052491.1.22890 WP_001052491.1.22924 WP_001052491.1.22969 WP_001052491.1.22975 WP_001052491.1.22983 WP_001052491.1.22984 WP_001052491.1.22994 WP_001052491.1.23004 WP_001052491.1.23008 WP_001052491.1.23012 WP_001052491.1.23048 WP_001052491.1.23061 WP_001052491.1.23069 WP_001052491.1.23082 WP_001052491.1.23103 WP_001052491.1.23121 WP_001052491.1.23130 WP_001052491.1.23132 WP_001052491.1.23133 WP_001052491.1.23146 WP_001052491.1.23152 WP_001052491.1.23161 WP_001052491.1.23185 WP_001052491.1.23194 WP_001052491.1.23197 WP_001052491.1.23217 WP_001052491.1.23222 WP_001052491.1.23228 WP_001052491.1.23238 WP_001052491.1.23244 WP_001052491.1.23251 WP_001052491.1.2327 WP_001052491.1.23275 WP_001052491.1.23288 WP_001052491.1.23304 WP_001052491.1.23381 WP_001052491.1.23413 WP_001052491.1.23420 WP_001052491.1.23431 WP_001052491.1.23439 WP_001052491.1.23449 WP_001052491.1.23450 WP_001052491.1.23476 WP_001052491.1.23489 WP_001052491.1.23491 WP_001052491.1.23516 WP_001052491.1.23517 WP_001052491.1.23531 WP_001052491.1.23541 WP_001052491.1.23544 WP_001052491.1.23557 WP_001052491.1.23568 WP_001052491.1.23572 WP_001052491.1.23580 WP_001052491.1.23586 WP_001052491.1.23613 WP_001052491.1.23617 WP_001052491.1.23626 WP_001052491.1.23630 WP_001052491.1.23644 WP_001052491.1.2365 WP_001052491.1.23671 WP_001052491.1.23690 WP_001052491.1.23708 WP_001052491.1.23710 WP_001052491.1.23730 WP_001052491.1.23740 WP_001052491.1.23796 WP_001052491.1.23809 WP_001052491.1.2382 WP_001052491.1.23822 WP_001052491.1.23842 WP_001052491.1.23849 WP_001052491.1.23856 WP_001052491.1.2389 WP_001052491.1.23896 WP_001052491.1.23900 WP_001052491.1.23902 WP_001052491.1.23907 WP_001052491.1.23926 WP_001052491.1.23935 WP_001052491.1.23944 WP_001052491.1.23956 WP_001052491.1.23972 WP_001052491.1.23995 WP_001052491.1.23998 WP_001052491.1.24000 WP_001052491.1.24081 WP_001052491.1.24129 WP_001052491.1.24148 WP_001052491.1.24154 WP_001052491.1.24174 WP_001052491.1.2420 WP_001052491.1.24207 WP_001052491.1.24213 WP_001052491.1.24226 WP_001052491.1.2423 WP_001052491.1.24241 WP_001052491.1.24263 WP_001052491.1.2427 WP_001052491.1.24275 WP_001052491.1.24276 WP_001052491.1.24277 WP_001052491.1.24279 WP_001052491.1.24286 WP_001052491.1.24302 WP_001052491.1.2434 WP_001052491.1.24343 WP_001052491.1.24347 WP_001052491.1.24364 WP_001052491.1.24365 WP_001052491.1.24388 WP_001052491.1.24416 WP_001052491.1.24418 WP_001052491.1.2442 WP_001052491.1.24436 WP_001052491.1.24437 WP_001052491.1.24439 WP_001052491.1.24443 WP_001052491.1.24456 WP_001052491.1.24462 WP_001052491.1.24469 WP_001052491.1.24478 WP_001052491.1.24502 WP_001052491.1.24503 WP_001052491.1.24516 WP_001052491.1.24519 WP_001052491.1.24569 WP_001052491.1.24572 WP_001052491.1.2458 WP_001052491.1.24589 WP_001052491.1.24596 WP_001052491.1.24597 WP_001052491.1.24602 WP_001052491.1.24617 WP_001052491.1.24625 WP_001052491.1.24631 WP_001052491.1.24644 WP_001052491.1.24654 WP_001052491.1.24674 WP_001052491.1.24679 WP_001052491.1.24681 WP_001052491.1.24684 WP_001052491.1.24685 WP_001052491.1.24702 WP_001052491.1.24711 WP_001052491.1.24714 WP_001052491.1.24745 WP_001052491.1.24780 WP_001052491.1.24781 WP_001052491.1.2480 WP_001052491.1.24802 WP_001052491.1.24817 WP_001052491.1.24823 WP_001052491.1.24834 WP_001052491.1.24855 WP_001052491.1.24856 WP_001052491.1.24891 WP_001052491.1.24903 WP_001052491.1.24915 WP_001052491.1.24918 WP_001052491.1.24937 WP_001052491.1.2497 WP_001052491.1.24996 WP_001052491.1.25001 WP_001052491.1.25007 WP_001052491.1.25012 WP_001052491.1.25029 WP_001052491.1.2506 WP_001052491.1.25070 WP_001052491.1.25083 WP_001052491.1.25092 WP_001052491.1.25095 WP_001052491.1.25098 WP_001052491.1.25115 WP_001052491.1.25117 WP_001052491.1.25120 WP_001052491.1.25145 WP_001052491.1.25167 WP_001052491.1.25170 WP_001052491.1.25187 WP_001052491.1.25209 WP_001052491.1.25216 WP_001052491.1.2522 WP_001052491.1.25221 WP_001052491.1.25262 WP_001052491.1.25287 WP_001052491.1.25288 WP_001052491.1.25331 WP_001052491.1.25341 WP_001052491.1.25345 WP_001052491.1.25361 WP_001052491.1.25433 WP_001052491.1.25438 WP_001052491.1.2544 WP_001052491.1.25459 WP_001052491.1.25469 WP_001052491.1.25479 WP_001052491.1.25488 WP_001052491.1.25489 WP_001052491.1.25495 WP_001052491.1.25511 WP_001052491.1.2552 WP_001052491.1.25557 WP_001052491.1.25567 WP_001052491.1.25569 WP_001052491.1.25591 WP_001052491.1.25593 WP_001052491.1.25595 WP_001052491.1.25597 WP_001052491.1.25621 WP_001052491.1.25623 WP_001052491.1.25632 WP_001052491.1.25633 WP_001052491.1.25634 WP_001052491.1.25651 WP_001052491.1.257 WP_001052491.1.25721 WP_001052491.1.25732 WP_001052491.1.25737 WP_001052491.1.25744 WP_001052491.1.25758 WP_001052491.1.25770 WP_001052491.1.25772 WP_001052491.1.25776 WP_001052491.1.25779 WP_001052491.1.2579 WP_001052491.1.25801 WP_001052491.1.25802 WP_001052491.1.25820 WP_001052491.1.25840 WP_001052491.1.25852 WP_001052491.1.25856 WP_001052491.1.25857 WP_001052491.1.25867 WP_001052491.1.25868 WP_001052491.1.25881 WP_001052491.1.25891 WP_001052491.1.2590 WP_001052491.1.25910 WP_001052491.1.2592 WP_001052491.1.25924 WP_001052491.1.25929 WP_001052491.1.2593 WP_001052491.1.25930 WP_001052491.1.25955 WP_001052491.1.25984 WP_001052491.1.26006 WP_001052491.1.26012 WP_001052491.1.26015 WP_001052491.1.26033 WP_001052491.1.26039 WP_001052491.1.26050 WP_001052491.1.26058 WP_001052491.1.2608 WP_001052491.1.26086 WP_001052491.1.26094 WP_001052491.1.26106 WP_001052491.1.26143 WP_001052491.1.26169 WP_001052491.1.26172 WP_001052491.1.2619 WP_001052491.1.262 WP_001052491.1.2621 WP_001052491.1.26225 WP_001052491.1.26226 WP_001052491.1.26255 WP_001052491.1.26266 WP_001052491.1.26271 WP_001052491.1.26276 WP_001052491.1.26283 WP_001052491.1.26289 WP_001052491.1.26290 WP_001052491.1.26293 WP_001052491.1.26298 WP_001052491.1.26306 WP_001052491.1.26307 WP_001052491.1.26314 WP_001052491.1.26315 WP_001052491.1.26318 WP_001052491.1.2633 WP_001052491.1.26340 WP_001052491.1.26345 WP_001052491.1.26346 WP_001052491.1.26354 WP_001052491.1.26364 WP_001052491.1.26370 WP_001052491.1.26390 WP_001052491.1.26397 WP_001052491.1.26399 WP_001052491.1.26404 WP_001052491.1.26405 WP_001052491.1.26424 WP_001052491.1.2643 WP_001052491.1.26431 WP_001052491.1.2645 WP_001052491.1.26481 WP_001052491.1.26506 WP_001052491.1.26533 WP_001052491.1.2656 WP_001052491.1.2658 WP_001052491.1.26584 WP_001052491.1.2661 WP_001052491.1.26626 WP_001052491.1.2664 WP_001052491.1.26650 WP_001052491.1.26662 WP_001052491.1.26663 WP_001052491.1.26664 WP_001052491.1.26677 WP_001052491.1.26692 WP_001052491.1.26713 WP_001052491.1.26726 WP_001052491.1.2673 WP_001052491.1.26733 WP_001052491.1.2674 WP_001052491.1.26749 WP_001052491.1.26751 WP_001052491.1.26771 WP_001052491.1.26772 WP_001052491.1.26773 WP_001052491.1.26778 WP_001052491.1.26790 WP_001052491.1.2680 WP_001052491.1.26804 WP_001052491.1.2684 WP_001052491.1.26840 WP_001052491.1.26850 WP_001052491.1.26864 WP_001052491.1.26865 WP_001052491.1.2687 WP_001052491.1.26884 WP_001052491.1.26886 WP_001052491.1.2689 WP_001052491.1.26903 WP_001052491.1.26905 WP_001052491.1.26927 WP_001052491.1.26929 WP_001052491.1.26938 WP_001052491.1.26944 WP_001052491.1.26947 WP_001052491.1.26958 WP_001052491.1.26963 WP_001052491.1.2697 WP_001052491.1.27013 WP_001052491.1.27042 WP_001052491.1.27053 WP_001052491.1.27080 WP_001052491.1.27083 WP_001052491.1.27097 WP_001052491.1.2710 WP_001052491.1.27120 WP_001052491.1.27127 WP_001052491.1.27147 WP_001052491.1.27154 WP_001052491.1.27160 WP_001052491.1.27166 WP_001052491.1.27168 WP_001052491.1.27170 WP_001052491.1.2718 WP_001052491.1.27182 WP_001052491.1.2719 WP_001052491.1.27199 WP_001052491.1.27207 WP_001052491.1.27226 WP_001052491.1.27246 WP_001052491.1.2725 WP_001052491.1.27262 WP_001052491.1.27293 WP_001052491.1.27294 WP_001052491.1.27303 WP_001052491.1.27311 WP_001052491.1.27323 WP_001052491.1.27333 WP_001052491.1.2734 WP_001052491.1.27345 WP_001052491.1.27379 WP_001052491.1.27384 WP_001052491.1.27387 WP_001052491.1.27413 WP_001052491.1.27415 WP_001052491.1.2744 WP_001052491.1.27447 WP_001052491.1.27448 WP_001052491.1.27455 WP_001052491.1.27456 WP_001052491.1.27457 WP_001052491.1.27467 WP_001052491.1.27468 WP_001052491.1.27489 WP_001052491.1.27516 WP_001052491.1.27529 WP_001052491.1.2753 WP_001052491.1.27539 WP_001052491.1.27551 WP_001052491.1.27562 WP_001052491.1.2759 WP_001052491.1.27590 WP_001052491.1.27605 WP_001052491.1.27608 WP_001052491.1.27614 WP_001052491.1.27615 WP_001052491.1.27621 WP_001052491.1.27622 WP_001052491.1.27628 WP_001052491.1.27640 WP_001052491.1.27646 WP_001052491.1.27654 WP_001052491.1.27662 WP_001052491.1.27667 WP_001052491.1.27670 WP_001052491.1.27673 WP_001052491.1.2768 WP_001052491.1.27689 WP_001052491.1.27696 WP_001052491.1.27717 WP_001052491.1.27720 WP_001052491.1.27739 WP_001052491.1.27744 WP_001052491.1.27748 WP_001052491.1.27765 WP_001052491.1.27787 WP_001052491.1.27793 WP_001052491.1.27799 WP_001052491.1.27817 WP_001052491.1.27830 WP_001052491.1.27834 WP_001052491.1.27854 WP_001052491.1.27929 WP_001052491.1.2795 WP_001052491.1.27950 WP_001052491.1.27953 WP_001052491.1.27972 WP_001052491.1.27999 WP_001052491.1.2800 WP_001052491.1.28007 WP_001052491.1.28016 WP_001052491.1.28025 WP_001052491.1.28063 WP_001052491.1.28071 WP_001052491.1.28074 WP_001052491.1.28079 WP_001052491.1.2808 WP_001052491.1.28081 WP_001052491.1.28088 WP_001052491.1.28091 WP_001052491.1.28105 WP_001052491.1.28107 WP_001052491.1.28117 WP_001052491.1.28138 WP_001052491.1.28147 WP_001052491.1.28158 WP_001052491.1.28173 WP_001052491.1.28191 WP_001052491.1.28213 WP_001052491.1.28226 WP_001052491.1.28230 WP_001052491.1.28253 WP_001052491.1.28257 WP_001052491.1.28274 WP_001052491.1.28298 WP_001052491.1.28315 WP_001052491.1.28319 WP_001052491.1.28334 WP_001052491.1.28336 WP_001052491.1.28337 WP_001052491.1.28347 WP_001052491.1.28358 WP_001052491.1.28360 WP_001052491.1.28376 WP_001052491.1.28381 WP_001052491.1.28388 WP_001052491.1.28392 WP_001052491.1.28394 WP_001052491.1.28399 WP_001052491.1.2840 WP_001052491.1.28400 WP_001052491.1.28430 WP_001052491.1.28447 WP_001052491.1.28477 WP_001052491.1.28482 WP_001052491.1.28490 WP_001052491.1.28498 WP_001052491.1.28501 WP_001052491.1.28502 WP_001052491.1.2852 WP_001052491.1.28526 WP_001052491.1.28527 WP_001052491.1.28532 WP_001052491.1.28564 WP_001052491.1.28578 WP_001052491.1.28580 WP_001052491.1.28584 WP_001052491.1.28605 WP_001052491.1.28614 WP_001052491.1.2862 WP_001052491.1.28629 WP_001052491.1.28636 WP_001052491.1.28650 WP_001052491.1.28652 WP_001052491.1.28672 WP_001052491.1.28675 WP_001052491.1.28690 WP_001052491.1.28691 WP_001052491.1.28710 WP_001052491.1.28720 WP_001052491.1.28725 WP_001052491.1.28763 WP_001052491.1.28784 WP_001052491.1.28785 WP_001052491.1.28825 WP_001052491.1.28833 WP_001052491.1.28848 WP_001052491.1.28862 WP_001052491.1.28866 WP_001052491.1.28871 WP_001052491.1.28874 WP_001052491.1.28887 WP_001052491.1.28909 WP_001052491.1.2891 WP_001052491.1.28915 WP_001052491.1.28925 WP_001052491.1.28933 WP_001052491.1.28934 WP_001052491.1.28960 WP_001052491.1.28970 WP_001052491.1.28981 WP_001052491.1.28987 WP_001052491.1.29014 WP_001052491.1.29052 WP_001052491.1.2906 WP_001052491.1.29060 WP_001052491.1.29090 WP_001052491.1.29091 WP_001052491.1.29107 WP_001052491.1.29110 WP_001052491.1.29112 WP_001052491.1.2913 WP_001052491.1.29155 WP_001052491.1.29166 WP_001052491.1.29170 WP_001052491.1.29187 WP_001052491.1.29188 WP_001052491.1.29207 WP_001052491.1.29226 WP_001052491.1.29242 WP_001052491.1.29243 WP_001052491.1.29244 WP_001052491.1.29250 WP_001052491.1.29263 WP_001052491.1.29268 WP_001052491.1.29272 WP_001052491.1.29276 WP_001052491.1.29282 WP_001052491.1.29285 WP_001052491.1.29301 WP_001052491.1.29312 WP_001052491.1.29315 WP_001052491.1.29329 WP_001052491.1.29340 WP_001052491.1.29366 WP_001052491.1.29368 WP_001052491.1.29372 WP_001052491.1.29373 WP_001052491.1.29375 WP_001052491.1.29395 WP_001052491.1.29420 WP_001052491.1.29433 WP_001052491.1.29445 WP_001052491.1.29453 WP_001052491.1.29468 WP_001052491.1.29479 WP_001052491.1.29483 WP_001052491.1.29484 WP_001052491.1.29507 WP_001052491.1.29511 WP_001052491.1.29522 WP_001052491.1.29541 WP_001052491.1.29553 WP_001052491.1.29554 WP_001052491.1.29557 WP_001052491.1.29560 WP_001052491.1.29561 WP_001052491.1.2957 WP_001052491.1.29571 WP_001052491.1.29596 WP_001052491.1.29644 WP_001052491.1.29676 WP_001052491.1.29692 WP_001052491.1.29709 WP_001052491.1.29710 WP_001052491.1.29716 WP_001052491.1.2972 WP_001052491.1.29731 WP_001052491.1.29736 WP_001052491.1.29744 WP_001052491.1.2975 WP_001052491.1.29758 WP_001052491.1.29781 WP_001052491.1.29788 WP_001052491.1.29805 WP_001052491.1.2981 WP_001052491.1.29826 WP_001052491.1.2983 WP_001052491.1.29862 WP_001052491.1.29885 WP_001052491.1.29902 WP_001052491.1.29905 WP_001052491.1.29918 WP_001052491.1.29956 WP_001052491.1.29963 WP_001052491.1.2997 WP_001052491.1.29981 WP_001052491.1.29982 WP_001052491.1.30012 WP_001052491.1.30023 WP_001052491.1.30033 WP_001052491.1.30047 WP_001052491.1.30051 WP_001052491.1.30057 WP_001052491.1.30089 WP_001052491.1.30095 WP_001052491.1.30100 WP_001052491.1.30115 WP_001052491.1.3012 WP_001052491.1.30130 WP_001052491.1.30150 WP_001052491.1.30152 WP_001052491.1.30154 WP_001052491.1.30159 WP_001052491.1.30169 WP_001052491.1.30176 WP_001052491.1.30186 WP_001052491.1.30188 WP_001052491.1.30190 WP_001052491.1.30191 WP_001052491.1.30197 WP_001052491.1.30203 WP_001052491.1.30204 WP_001052491.1.30209 WP_001052491.1.30230 WP_001052491.1.30249 WP_001052491.1.30262 WP_001052491.1.30268 WP_001052491.1.30274 WP_001052491.1.3029 WP_001052491.1.30294 WP_001052491.1.30302 WP_001052491.1.30307 WP_001052491.1.30328 WP_001052491.1.30333 WP_001052491.1.30350 WP_001052491.1.30364 WP_001052491.1.30367 WP_001052491.1.30376 WP_001052491.1.30381 WP_001052491.1.30385 WP_001052491.1.30392 WP_001052491.1.30418 WP_001052491.1.30422 WP_001052491.1.30458 WP_001052491.1.30477 WP_001052491.1.30482 WP_001052491.1.30496 WP_001052491.1.3050 WP_001052491.1.30508 WP_001052491.1.30530 WP_001052491.1.30531 WP_001052491.1.30560 WP_001052491.1.30566 WP_001052491.1.30568 WP_001052491.1.30600 WP_001052491.1.30622 WP_001052491.1.30623 WP_001052491.1.30645 WP_001052491.1.30646 WP_001052491.1.30648 WP_001052491.1.30650 WP_001052491.1.30652 WP_001052491.1.30666 WP_001052491.1.30668 WP_001052491.1.30690 WP_001052491.1.30702 WP_001052491.1.30720 WP_001052491.1.30726 WP_001052491.1.30758 WP_001052491.1.30763 WP_001052491.1.30768 WP_001052491.1.3077 WP_001052491.1.30779 WP_001052491.1.30840 WP_001052491.1.30845 WP_001052491.1.30846 WP_001052491.1.30847 WP_001052491.1.30854 WP_001052491.1.30861 WP_001052491.1.30862 WP_001052491.1.30863 WP_001052491.1.30874 WP_001052491.1.30878 WP_001052491.1.30880 WP_001052491.1.30889 WP_001052491.1.30907 WP_001052491.1.30911 WP_001052491.1.30915 WP_001052491.1.30916 WP_001052491.1.30928 WP_001052491.1.30945 WP_001052491.1.30962 WP_001052491.1.3097 WP_001052491.1.30970 WP_001052491.1.30971 WP_001052491.1.30998 WP_001052491.1.31005 WP_001052491.1.31022 WP_001052491.1.31025 WP_001052491.1.31037 WP_001052491.1.31039 WP_001052491.1.31041 WP_001052491.1.31048 WP_001052491.1.31065 WP_001052491.1.31068 WP_001052491.1.31077 WP_001052491.1.31091 WP_001052491.1.31113 WP_001052491.1.31114 WP_001052491.1.31120 WP_001052491.1.31123 WP_001052491.1.31124 WP_001052491.1.31176 WP_001052491.1.31194 WP_001052491.1.31202 WP_001052491.1.31204 WP_001052491.1.31206 WP_001052491.1.31212 WP_001052491.1.3123 WP_001052491.1.31232 WP_001052491.1.31278 WP_001052491.1.31294 WP_001052491.1.31315 WP_001052491.1.3132 WP_001052491.1.31337 WP_001052491.1.31339 WP_001052491.1.31355 WP_001052491.1.31363 WP_001052491.1.31376 WP_001052491.1.31377 WP_001052491.1.31402 WP_001052491.1.31424 WP_001052491.1.31426 WP_001052491.1.31436 WP_001052491.1.31437 WP_001052491.1.31441 WP_001052491.1.31442 WP_001052491.1.31462 WP_001052491.1.31468 WP_001052491.1.31478 WP_001052491.1.31479 WP_001052491.1.31484 WP_001052491.1.31497 WP_001052491.1.315 WP_001052491.1.31505 WP_001052491.1.31529 WP_001052491.1.31531 WP_001052491.1.31539 WP_001052491.1.31567 WP_001052491.1.31568 WP_001052491.1.31589 WP_001052491.1.31605 WP_001052491.1.31611 WP_001052491.1.31621 WP_001052491.1.31638 WP_001052491.1.31642 WP_001052491.1.31647 WP_001052491.1.31653 WP_001052491.1.31667 WP_001052491.1.31686 WP_001052491.1.31701 WP_001052491.1.31743 WP_001052491.1.31753 WP_001052491.1.31787 WP_001052491.1.31791 WP_001052491.1.31797 WP_001052491.1.31806 WP_001052491.1.31816 WP_001052491.1.31817 WP_001052491.1.31827 WP_001052491.1.31828 WP_001052491.1.31842 WP_001052491.1.3188 WP_001052491.1.31892 WP_001052491.1.31897 WP_001052491.1.31925 WP_001052491.1.31931 WP_001052491.1.31943 WP_001052491.1.31949 WP_001052491.1.31990 WP_001052491.1.31994 WP_001052491.1.31997 WP_001052491.1.32003 WP_001052491.1.32005 WP_001052491.1.32029 WP_001052491.1.32040 WP_001052491.1.32059 WP_001052491.1.32067 WP_001052491.1.32077 WP_001052491.1.32095 WP_001052491.1.32106 WP_001052491.1.32118 WP_001052491.1.32122 WP_001052491.1.32125 WP_001052491.1.32130 WP_001052491.1.32160 WP_001052491.1.32167 WP_001052491.1.3219 WP_001052491.1.32207 WP_001052491.1.32217 WP_001052491.1.32244 WP_001052491.1.32248 WP_001052491.1.32269 WP_001052491.1.32270 WP_001052491.1.32281 WP_001052491.1.3229 WP_001052491.1.32295 WP_001052491.1.32301 WP_001052491.1.3231 WP_001052491.1.32325 WP_001052491.1.32338 WP_001052491.1.32339 WP_001052491.1.32340 WP_001052491.1.32348 WP_001052491.1.32365 WP_001052491.1.32384 WP_001052491.1.32405 WP_001052491.1.3242 WP_001052491.1.3244 WP_001052491.1.32454 WP_001052491.1.32464 WP_001052491.1.32474 WP_001052491.1.32481 WP_001052491.1.32483 WP_001052491.1.32497 WP_001052491.1.32514 WP_001052491.1.32517 WP_001052491.1.32534 WP_001052491.1.32546 WP_001052491.1.32555 WP_001052491.1.32565 WP_001052491.1.32584 WP_001052491.1.32588 WP_001052491.1.32599 WP_001052491.1.32607 WP_001052491.1.32634 WP_001052491.1.32636 WP_001052491.1.32645 WP_001052491.1.32671 WP_001052491.1.32739 WP_001052491.1.32746 WP_001052491.1.32754 WP_001052491.1.32761 WP_001052491.1.32763 WP_001052491.1.32764 WP_001052491.1.32770 WP_001052491.1.32795 WP_001052491.1.328 WP_001052491.1.32800 WP_001052491.1.32829 WP_001052491.1.32839 WP_001052491.1.32898 WP_001052491.1.32921 WP_001052491.1.32925 WP_001052491.1.32928 WP_001052491.1.3293 WP_001052491.1.32939 WP_001052491.1.32954 WP_001052491.1.32965 WP_001052491.1.32980 WP_001052491.1.32987 WP_001052491.1.3299 WP_001052491.1.33029 WP_001052491.1.33038 WP_001052491.1.3306 WP_001052491.1.33067 WP_001052491.1.33108 WP_001052491.1.33110 WP_001052491.1.33123 WP_001052491.1.33138 WP_001052491.1.33147 WP_001052491.1.3316 WP_001052491.1.33161 WP_001052491.1.33172 WP_001052491.1.33199 WP_001052491.1.33212 WP_001052491.1.33213 WP_001052491.1.33250 WP_001052491.1.33252 WP_001052491.1.33255 WP_001052491.1.33266 WP_001052491.1.33277 WP_001052491.1.33292 WP_001052491.1.33296 WP_001052491.1.3330 WP_001052491.1.33307 WP_001052491.1.33322 WP_001052491.1.33328 WP_001052491.1.33335 WP_001052491.1.33350 WP_001052491.1.33357 WP_001052491.1.33368 WP_001052491.1.33372 WP_001052491.1.3338 WP_001052491.1.33388 WP_001052491.1.33394 WP_001052491.1.3341 WP_001052491.1.33416 WP_001052491.1.3342 WP_001052491.1.33426 WP_001052491.1.3343 WP_001052491.1.33432 WP_001052491.1.3345 WP_001052491.1.33463 WP_001052491.1.33468 WP_001052491.1.3347 WP_001052491.1.33483 WP_001052491.1.33484 WP_001052491.1.33507 WP_001052491.1.33516 WP_001052491.1.33518 WP_001052491.1.33520 WP_001052491.1.33538 WP_001052491.1.33540 WP_001052491.1.33567 WP_001052491.1.3357 WP_001052491.1.33575 WP_001052491.1.3358 WP_001052491.1.33594 WP_001052491.1.33607 WP_001052491.1.33610 WP_001052491.1.33626 WP_001052491.1.33627 WP_001052491.1.3363 WP_001052491.1.33640 WP_001052491.1.33650 WP_001052491.1.33654 WP_001052491.1.33655 WP_001052491.1.33692 WP_001052491.1.33695 WP_001052491.1.33707 WP_001052491.1.33718 WP_001052491.1.33720 WP_001052491.1.33724 WP_001052491.1.33735 WP_001052491.1.33737 WP_001052491.1.33743 WP_001052491.1.33756 WP_001052491.1.33765 WP_001052491.1.33766 WP_001052491.1.33767 WP_001052491.1.33769 WP_001052491.1.33778 WP_001052491.1.33792 WP_001052491.1.33804 WP_001052491.1.33813 WP_001052491.1.33816 WP_001052491.1.33850 WP_001052491.1.33855 WP_001052491.1.33899 WP_001052491.1.33915 WP_001052491.1.33940 WP_001052491.1.33949 WP_001052491.1.33963 WP_001052491.1.33966 WP_001052491.1.33968 WP_001052491.1.33971 WP_001052491.1.33983 WP_001052491.1.33989 WP_001052491.1.33994 WP_001052491.1.34026 WP_001052491.1.34030 WP_001052491.1.34051 WP_001052491.1.34060 WP_001052491.1.34062 WP_001052491.1.34069 WP_001052491.1.34078 WP_001052491.1.34079 WP_001052491.1.34080 WP_001052491.1.34089 WP_001052491.1.34100 WP_001052491.1.34105 WP_001052491.1.34112 WP_001052491.1.34128 WP_001052491.1.34132 WP_001052491.1.34168 WP_001052491.1.3417 WP_001052491.1.34172 WP_001052491.1.3418 WP_001052491.1.34182 WP_001052491.1.34194 WP_001052491.1.34209 WP_001052491.1.3422 WP_001052491.1.34223 WP_001052491.1.34231 WP_001052491.1.34240 WP_001052491.1.34244 WP_001052491.1.34250 WP_001052491.1.34251 WP_001052491.1.34254 WP_001052491.1.34280 WP_001052491.1.34285 WP_001052491.1.34307 WP_001052491.1.34334 WP_001052491.1.34361 WP_001052491.1.34371 WP_001052491.1.34381 WP_001052491.1.34403 WP_001052491.1.34410 WP_001052491.1.3442 WP_001052491.1.34427 WP_001052491.1.34436 WP_001052491.1.34438 WP_001052491.1.34471 WP_001052491.1.34473 WP_001052491.1.3448 WP_001052491.1.34482 WP_001052491.1.34492 WP_001052491.1.34502 WP_001052491.1.34510 WP_001052491.1.34512 WP_001052491.1.34526 WP_001052491.1.34531 WP_001052491.1.34569 WP_001052491.1.34578 WP_001052491.1.3461 WP_001052491.1.34620 WP_001052491.1.34626 WP_001052491.1.34666 WP_001052491.1.34677 WP_001052491.1.34716 WP_001052491.1.34723 WP_001052491.1.34733 WP_001052491.1.34737 WP_001052491.1.3474 WP_001052491.1.34741 WP_001052491.1.34767 WP_001052491.1.34774 WP_001052491.1.34818 WP_001052491.1.34847 WP_001052491.1.34877 WP_001052491.1.34890 WP_001052491.1.34912 WP_001052491.1.34918 WP_001052491.1.34923 WP_001052491.1.34926 WP_001052491.1.34943 WP_001052491.1.34967 WP_001052491.1.34970 WP_001052491.1.34998 WP_001052491.1.35014 WP_001052491.1.35029 WP_001052491.1.35031 WP_001052491.1.35032 WP_001052491.1.35054 WP_001052491.1.35059 WP_001052491.1.35062 WP_001052491.1.35089 WP_001052491.1.35097 WP_001052491.1.35106 WP_001052491.1.35108 WP_001052491.1.35110 WP_001052491.1.35121 WP_001052491.1.35177 WP_001052491.1.35182 WP_001052491.1.35183 WP_001052491.1.35189 WP_001052491.1.35194 WP_001052491.1.35222 WP_001052491.1.35233 WP_001052491.1.35243 WP_001052491.1.35257 WP_001052491.1.3526 WP_001052491.1.35264 WP_001052491.1.35276 WP_001052491.1.35285 WP_001052491.1.35289 WP_001052491.1.35297 WP_001052491.1.35307 WP_001052491.1.35314 WP_001052491.1.35334 WP_001052491.1.35340 WP_001052491.1.35342 WP_001052491.1.35345 WP_001052491.1.35352 WP_001052491.1.35391 WP_001052491.1.354 WP_001052491.1.35413 WP_001052491.1.35415 WP_001052491.1.3542 WP_001052491.1.35422 WP_001052491.1.35423 WP_001052491.1.35433 WP_001052491.1.35435 WP_001052491.1.3547 WP_001052491.1.3549 WP_001052491.1.35490 WP_001052491.1.35497 WP_001052491.1.35498 WP_001052491.1.35506 WP_001052491.1.35508 WP_001052491.1.35517 WP_001052491.1.35519 WP_001052491.1.3552 WP_001052491.1.35525 WP_001052491.1.35580 WP_001052491.1.35615 WP_001052491.1.35623 WP_001052491.1.35642 WP_001052491.1.35643 WP_001052491.1.35659 WP_001052491.1.35661 WP_001052491.1.35673 WP_001052491.1.35686 WP_001052491.1.3569 WP_001052491.1.35696 WP_001052491.1.35730 WP_001052491.1.3574 WP_001052491.1.35742 WP_001052491.1.35746 WP_001052491.1.35774 WP_001052491.1.35784 WP_001052491.1.3579 WP_001052491.1.35794 WP_001052491.1.35799 WP_001052491.1.35801 WP_001052491.1.35826 WP_001052491.1.35837 WP_001052491.1.35871 WP_001052491.1.35888 WP_001052491.1.35890 WP_001052491.1.35900 WP_001052491.1.35903 WP_001052491.1.35928 WP_001052491.1.35933 WP_001052491.1.35950 WP_001052491.1.35958 WP_001052491.1.35989 WP_001052491.1.36004 WP_001052491.1.36013 WP_001052491.1.36021 WP_001052491.1.36041 WP_001052491.1.36082 WP_001052491.1.36093 WP_001052491.1.36102 WP_001052491.1.3611 WP_001052491.1.36117 WP_001052491.1.36119 WP_001052491.1.36141 WP_001052491.1.3617 WP_001052491.1.36175 WP_001052491.1.36176 WP_001052491.1.36187 WP_001052491.1.36188 WP_001052491.1.36193 WP_001052491.1.36208 WP_001052491.1.36211 WP_001052491.1.36220 WP_001052491.1.36223 WP_001052491.1.3623 WP_001052491.1.36231 WP_001052491.1.36249 WP_001052491.1.36250 WP_001052491.1.36264 WP_001052491.1.36278 WP_001052491.1.36282 WP_001052491.1.36302 WP_001052491.1.36307 WP_001052491.1.36325 WP_001052491.1.36344 WP_001052491.1.36389 WP_001052491.1.36430 WP_001052491.1.36434 WP_001052491.1.36439 WP_001052491.1.36522 WP_001052491.1.36532 WP_001052491.1.36535 WP_001052491.1.3655 WP_001052491.1.36551 WP_001052491.1.36570 WP_001052491.1.36580 WP_001052491.1.3659 WP_001052491.1.36600 WP_001052491.1.36604 WP_001052491.1.36615 WP_001052491.1.36640 WP_001052491.1.36646 WP_001052491.1.3666 WP_001052491.1.36669 WP_001052491.1.36689 WP_001052491.1.36697 WP_001052491.1.36698 WP_001052491.1.36704 WP_001052491.1.36729 WP_001052491.1.36745 WP_001052491.1.3675 WP_001052491.1.36754 WP_001052491.1.36770 WP_001052491.1.36773 WP_001052491.1.36783 WP_001052491.1.36793 WP_001052491.1.36796 WP_001052491.1.36797 WP_001052491.1.36809 WP_001052491.1.36814 WP_001052491.1.36820 WP_001052491.1.36822 WP_001052491.1.36823 WP_001052491.1.36847 WP_001052491.1.3685 WP_001052491.1.36858 WP_001052491.1.3687 WP_001052491.1.36884 WP_001052491.1.36888 WP_001052491.1.3690 WP_001052491.1.36903 WP_001052491.1.36911 WP_001052491.1.36916 WP_001052491.1.36932 WP_001052491.1.36952 WP_001052491.1.36955 WP_001052491.1.36962 WP_001052491.1.36979 WP_001052491.1.36980 WP_001052491.1.36996 WP_001052491.1.36997 WP_001052491.1.37002 WP_001052491.1.37016 WP_001052491.1.3703 WP_001052491.1.37044 WP_001052491.1.37045 WP_001052491.1.37053 WP_001052491.1.37055 WP_001052491.1.37075 WP_001052491.1.37080 WP_001052491.1.3709 WP_001052491.1.37091 WP_001052491.1.37120 WP_001052491.1.37121 WP_001052491.1.37130 WP_001052491.1.37132 WP_001052491.1.37134 WP_001052491.1.37135 WP_001052491.1.37145 WP_001052491.1.37159 WP_001052491.1.3718 WP_001052491.1.37182 WP_001052491.1.3719 WP_001052491.1.3722 WP_001052491.1.37220 WP_001052491.1.37240 WP_001052491.1.37304 WP_001052491.1.37335 WP_001052491.1.37336 WP_001052491.1.37341 WP_001052491.1.37343 WP_001052491.1.37354 WP_001052491.1.37378 WP_001052491.1.37398 WP_001052491.1.37408 WP_001052491.1.37411 WP_001052491.1.37424 WP_001052491.1.37435 WP_001052491.1.37453 WP_001052491.1.37467 WP_001052491.1.37503 WP_001052491.1.37525 WP_001052491.1.37536 WP_001052491.1.37546 WP_001052491.1.37551 WP_001052491.1.37563 WP_001052491.1.37578 WP_001052491.1.37583 WP_001052491.1.37602 WP_001052491.1.37605 WP_001052491.1.37606 WP_001052491.1.37621 WP_001052491.1.37624 WP_001052491.1.37636 WP_001052491.1.37644 WP_001052491.1.37652 WP_001052491.1.37669 WP_001052491.1.37679 WP_001052491.1.3774 WP_001052491.1.37749 WP_001052491.1.3776 WP_001052491.1.37764 WP_001052491.1.37771 WP_001052491.1.37781 WP_001052491.1.37788 WP_001052491.1.37795 WP_001052491.1.37815 WP_001052491.1.37828 WP_001052491.1.37851 WP_001052491.1.37855 WP_001052491.1.37866 WP_001052491.1.37875 WP_001052491.1.37878 WP_001052491.1.37891 WP_001052491.1.37906 WP_001052491.1.37907 WP_001052491.1.37929 WP_001052491.1.37953 WP_001052491.1.37987 WP_001052491.1.38007 WP_001052491.1.38020 WP_001052491.1.38030 WP_001052491.1.38034 WP_001052491.1.38038 WP_001052491.1.38057 WP_001052491.1.38070 WP_001052491.1.38082 WP_001052491.1.3809 WP_001052491.1.38100 WP_001052491.1.38111 WP_001052491.1.38128 WP_001052491.1.3813 WP_001052491.1.38136 WP_001052491.1.38148 WP_001052491.1.38160 WP_001052491.1.3817 WP_001052491.1.38176 WP_001052491.1.38177 WP_001052491.1.3820 WP_001052491.1.38212 WP_001052491.1.38222 WP_001052491.1.38229 WP_001052491.1.38230 WP_001052491.1.38232 WP_001052491.1.38259 WP_001052491.1.3827 WP_001052491.1.38276 WP_001052491.1.38282 WP_001052491.1.38304 WP_001052491.1.38309 WP_001052491.1.38311 WP_001052491.1.38316 WP_001052491.1.38330 WP_001052491.1.38336 WP_001052491.1.38339 WP_001052491.1.38346 WP_001052491.1.38383 WP_001052491.1.38390 WP_001052491.1.3842 WP_001052491.1.38422 WP_001052491.1.38435 WP_001052491.1.38437 WP_001052491.1.38453 WP_001052491.1.38489 WP_001052491.1.38491 WP_001052491.1.38493 WP_001052491.1.38516 WP_001052491.1.3852 WP_001052491.1.38522 WP_001052491.1.38546 WP_001052491.1.38551 WP_001052491.1.38555 WP_001052491.1.38557 WP_001052491.1.38600 WP_001052491.1.38607 WP_001052491.1.38612 WP_001052491.1.38617 WP_001052491.1.38637 WP_001052491.1.38651 WP_001052491.1.38658 WP_001052491.1.38669 WP_001052491.1.3867 WP_001052491.1.38674 WP_001052491.1.38688 WP_001052491.1.38721 WP_001052491.1.3875 WP_001052491.1.38760 WP_001052491.1.38786 WP_001052491.1.38788 WP_001052491.1.38823 WP_001052491.1.38836 WP_001052491.1.38841 WP_001052491.1.38858 WP_001052491.1.38862 WP_001052491.1.38875 WP_001052491.1.38885 WP_001052491.1.38890 WP_001052491.1.38926 WP_001052491.1.38927 WP_001052491.1.38931 WP_001052491.1.3894 WP_001052491.1.38940 WP_001052491.1.38941 WP_001052491.1.38943 WP_001052491.1.38960 WP_001052491.1.38972 WP_001052491.1.38973 WP_001052491.1.38979 WP_001052491.1.38985 WP_001052491.1.38989 WP_001052491.1.390 WP_001052491.1.39012 WP_001052491.1.39014 WP_001052491.1.39017 WP_001052491.1.39026 WP_001052491.1.39043 WP_001052491.1.39053 WP_001052491.1.3906 WP_001052491.1.3908 WP_001052491.1.39080 WP_001052491.1.39089 WP_001052491.1.391 WP_001052491.1.39108 WP_001052491.1.39117 WP_001052491.1.39126 WP_001052491.1.39166 WP_001052491.1.39173 WP_001052491.1.39203 WP_001052491.1.39206 WP_001052491.1.39217 WP_001052491.1.39241 WP_001052491.1.3926 WP_001052491.1.39272 WP_001052491.1.39281 WP_001052491.1.39285 WP_001052491.1.39290 WP_001052491.1.39324 WP_001052491.1.39330 WP_001052491.1.39332 WP_001052491.1.39333 WP_001052491.1.39347 WP_001052491.1.39361 WP_001052491.1.39368 WP_001052491.1.39369 WP_001052491.1.39378 WP_001052491.1.39384 WP_001052491.1.39397 WP_001052491.1.39406 WP_001052491.1.39424 WP_001052491.1.39432 WP_001052491.1.39451 WP_001052491.1.39494 WP_001052491.1.39499 WP_001052491.1.39506 WP_001052491.1.39519 WP_001052491.1.39527 WP_001052491.1.39542 WP_001052491.1.39550 WP_001052491.1.39586 WP_001052491.1.39613 WP_001052491.1.39625 WP_001052491.1.39642 WP_001052491.1.39645 WP_001052491.1.39662 WP_001052491.1.39670 WP_001052491.1.39671 WP_001052491.1.39682 WP_001052491.1.39687 WP_001052491.1.39689 WP_001052491.1.39693 WP_001052491.1.39697 WP_001052491.1.39711 WP_001052491.1.39738 WP_001052491.1.39767 WP_001052491.1.39773 WP_001052491.1.39789 WP_001052491.1.39812 WP_001052491.1.39832 WP_001052491.1.39834 WP_001052491.1.39838 WP_001052491.1.39839 WP_001052491.1.39847 WP_001052491.1.39854 WP_001052491.1.39856 WP_001052491.1.39857 WP_001052491.1.39869 WP_001052491.1.39875 WP_001052491.1.39880 WP_001052491.1.39883 WP_001052491.1.39918 WP_001052491.1.39943 WP_001052491.1.39995 WP_001052491.1.40014 WP_001052491.1.40043 WP_001052491.1.40053 WP_001052491.1.4006 WP_001052491.1.40076 WP_001052491.1.40082 WP_001052491.1.40085 WP_001052491.1.40099 WP_001052491.1.4010 WP_001052491.1.40119 WP_001052491.1.4012 WP_001052491.1.40120 WP_001052491.1.40130 WP_001052491.1.40137 WP_001052491.1.40149 WP_001052491.1.4015 WP_001052491.1.40161 WP_001052491.1.40164 WP_001052491.1.40173 WP_001052491.1.4019 WP_001052491.1.40220 WP_001052491.1.40247 WP_001052491.1.4025 WP_001052491.1.40299 WP_001052491.1.40316 WP_001052491.1.40318 WP_001052491.1.40320 WP_001052491.1.40322 WP_001052491.1.40329 WP_001052491.1.40330 WP_001052491.1.40340 WP_001052491.1.40342 WP_001052491.1.40368 WP_001052491.1.40369 WP_001052491.1.40383 WP_001052491.1.40392 WP_001052491.1.40401 WP_001052491.1.40406 WP_001052491.1.40409 WP_001052491.1.40428 WP_001052491.1.40435 WP_001052491.1.40443 WP_001052491.1.4045 WP_001052491.1.40454 WP_001052491.1.40458 WP_001052491.1.40463 WP_001052491.1.40472 WP_001052491.1.40474 WP_001052491.1.40481 WP_001052491.1.40483 WP_001052491.1.40500 WP_001052491.1.40505 WP_001052491.1.40531 WP_001052491.1.40532 WP_001052491.1.40554 WP_001052491.1.4056 WP_001052491.1.4057 WP_001052491.1.40579 WP_001052491.1.40588 WP_001052491.1.40613 WP_001052491.1.40620 WP_001052491.1.40644 WP_001052491.1.40655 WP_001052491.1.40658 WP_001052491.1.40659 WP_001052491.1.40664 WP_001052491.1.40670 WP_001052491.1.40700 WP_001052491.1.40719 WP_001052491.1.40729 WP_001052491.1.40748 WP_001052491.1.40760 WP_001052491.1.4078 WP_001052491.1.40780 WP_001052491.1.40794 WP_001052491.1.40797 WP_001052491.1.40800 WP_001052491.1.40814 WP_001052491.1.40816 WP_001052491.1.40939 WP_001052491.1.40954 WP_001052491.1.40997 WP_001052491.1.41002 WP_001052491.1.41005 WP_001052491.1.41011 WP_001052491.1.4102 WP_001052491.1.41033 WP_001052491.1.41038 WP_001052491.1.4105 WP_001052491.1.41058 WP_001052491.1.41064 WP_001052491.1.41066 WP_001052491.1.41084 WP_001052491.1.41094 WP_001052491.1.41098 WP_001052491.1.41104 WP_001052491.1.41109 WP_001052491.1.41119 WP_001052491.1.41122 WP_001052491.1.41129 WP_001052491.1.41133 WP_001052491.1.4115 WP_001052491.1.41178 WP_001052491.1.412 WP_001052491.1.41208 WP_001052491.1.41238 WP_001052491.1.41241 WP_001052491.1.41245 WP_001052491.1.41255 WP_001052491.1.41288 WP_001052491.1.41289 WP_001052491.1.4129 WP_001052491.1.41314 WP_001052491.1.41341 WP_001052491.1.41350 WP_001052491.1.41374 WP_001052491.1.4138 WP_001052491.1.41386 WP_001052491.1.41389 WP_001052491.1.41411 WP_001052491.1.41426 WP_001052491.1.41432 WP_001052491.1.41433 WP_001052491.1.4144 WP_001052491.1.41444 WP_001052491.1.41448 WP_001052491.1.41456 WP_001052491.1.41458 WP_001052491.1.41461 WP_001052491.1.41473 WP_001052491.1.41499 WP_001052491.1.41511 WP_001052491.1.41532 WP_001052491.1.41533 WP_001052491.1.41537 WP_001052491.1.41555 WP_001052491.1.41558 WP_001052491.1.41567 WP_001052491.1.41581 WP_001052491.1.41582 WP_001052491.1.41587 WP_001052491.1.41597 WP_001052491.1.41598 WP_001052491.1.41599 WP_001052491.1.4160 WP_001052491.1.41612 WP_001052491.1.4162 WP_001052491.1.41620 WP_001052491.1.41623 WP_001052491.1.41647 WP_001052491.1.41674 WP_001052491.1.41679 WP_001052491.1.41681 WP_001052491.1.4169 WP_001052491.1.41698 WP_001052491.1.41726 WP_001052491.1.41743 WP_001052491.1.41755 WP_001052491.1.41770 WP_001052491.1.41796 WP_001052491.1.41805 WP_001052491.1.41817 WP_001052491.1.41819 WP_001052491.1.4182 WP_001052491.1.41821 WP_001052491.1.41839 WP_001052491.1.41863 WP_001052491.1.4188 WP_001052491.1.41891 WP_001052491.1.41898 WP_001052491.1.41906 WP_001052491.1.41915 WP_001052491.1.41935 WP_001052491.1.41943 WP_001052491.1.41954 WP_001052491.1.41972 WP_001052491.1.41983 WP_001052491.1.41989 WP_001052491.1.420 WP_001052491.1.42001 WP_001052491.1.42003 WP_001052491.1.42005 WP_001052491.1.42015 WP_001052491.1.42017 WP_001052491.1.4202 WP_001052491.1.42028 WP_001052491.1.42056 WP_001052491.1.42064 WP_001052491.1.42072 WP_001052491.1.42085 WP_001052491.1.42087 WP_001052491.1.42125 WP_001052491.1.42137 WP_001052491.1.42169 WP_001052491.1.42177 WP_001052491.1.42178 WP_001052491.1.42198 WP_001052491.1.42211 WP_001052491.1.42230 WP_001052491.1.42241 WP_001052491.1.4225 WP_001052491.1.42269 WP_001052491.1.42286 WP_001052491.1.42298 WP_001052491.1.42305 WP_001052491.1.4231 WP_001052491.1.42325 WP_001052491.1.42336 WP_001052491.1.42344 WP_001052491.1.42355 WP_001052491.1.42403 WP_001052491.1.42436 WP_001052491.1.42438 WP_001052491.1.42455 WP_001052491.1.42459 WP_001052491.1.42460 WP_001052491.1.42481 WP_001052491.1.42503 WP_001052491.1.42510 WP_001052491.1.42517 WP_001052491.1.42551 WP_001052491.1.42575 WP_001052491.1.42593 WP_001052491.1.42598 WP_001052491.1.426 WP_001052491.1.4260 WP_001052491.1.42607 WP_001052491.1.42640 WP_001052491.1.42652 WP_001052491.1.42667 WP_001052491.1.42668 WP_001052491.1.42674 WP_001052491.1.42679 WP_001052491.1.42681 WP_001052491.1.42706 WP_001052491.1.42733 WP_001052491.1.42737 WP_001052491.1.42738 WP_001052491.1.42740 WP_001052491.1.42759 WP_001052491.1.42764 WP_001052491.1.42786 WP_001052491.1.42788 WP_001052491.1.42798 WP_001052491.1.42802 WP_001052491.1.42816 WP_001052491.1.42819 WP_001052491.1.42837 WP_001052491.1.42848 WP_001052491.1.42883 WP_001052491.1.42893 WP_001052491.1.42897 WP_001052491.1.42907 WP_001052491.1.42924 WP_001052491.1.42925 WP_001052491.1.4293 WP_001052491.1.42959 WP_001052491.1.42982 WP_001052491.1.42984 WP_001052491.1.42985 WP_001052491.1.4299 WP_001052491.1.42990 WP_001052491.1.4300 WP_001052491.1.43014 WP_001052491.1.43020 WP_001052491.1.43023 WP_001052491.1.43033 WP_001052491.1.43042 WP_001052491.1.43047 WP_001052491.1.43061 WP_001052491.1.43072 WP_001052491.1.43095 WP_001052491.1.43110 WP_001052491.1.43114 WP_001052491.1.43122 WP_001052491.1.43125 WP_001052491.1.43131 WP_001052491.1.43134 WP_001052491.1.43139 WP_001052491.1.43143 WP_001052491.1.43147 WP_001052491.1.43159 WP_001052491.1.43165 WP_001052491.1.43168 WP_001052491.1.43179 WP_001052491.1.43184 WP_001052491.1.43200 WP_001052491.1.43202 WP_001052491.1.43204 WP_001052491.1.43206 WP_001052491.1.43220 WP_001052491.1.43232 WP_001052491.1.43248 WP_001052491.1.4325 WP_001052491.1.43252 WP_001052491.1.43263 WP_001052491.1.4327 WP_001052491.1.43274 WP_001052491.1.43279 WP_001052491.1.43323 WP_001052491.1.43325 WP_001052491.1.43328 WP_001052491.1.43331 WP_001052491.1.43341 WP_001052491.1.43349 WP_001052491.1.43360 WP_001052491.1.43366 WP_001052491.1.43369 WP_001052491.1.4337 WP_001052491.1.43375 WP_001052491.1.43383 WP_001052491.1.43405 WP_001052491.1.43406 WP_001052491.1.4341 WP_001052491.1.43410 WP_001052491.1.43414 WP_001052491.1.43446 WP_001052491.1.43460 WP_001052491.1.4347 WP_001052491.1.43506 WP_001052491.1.43512 WP_001052491.1.43530 WP_001052491.1.43550 WP_001052491.1.43560 WP_001052491.1.43573 WP_001052491.1.43594 WP_001052491.1.43600 WP_001052491.1.43617 WP_001052491.1.43618 WP_001052491.1.43627 WP_001052491.1.43665 WP_001052491.1.43670 WP_001052491.1.43683 WP_001052491.1.4369 WP_001052491.1.43693 WP_001052491.1.4370 WP_001052491.1.43702 WP_001052491.1.43703 WP_001052491.1.4372 WP_001052491.1.43731 WP_001052491.1.4374 WP_001052491.1.43752 WP_001052491.1.43784 WP_001052491.1.43788 WP_001052491.1.4379 WP_001052491.1.43800 WP_001052491.1.43819 WP_001052491.1.43822 WP_001052491.1.43827 WP_001052491.1.43842 WP_001052491.1.4385 WP_001052491.1.43851 WP_001052491.1.4386 WP_001052491.1.43904 WP_001052491.1.43915 WP_001052491.1.43924 WP_001052491.1.43964 WP_001052491.1.43984 WP_001052491.1.43988 WP_001052491.1.43995 WP_001052491.1.44021 WP_001052491.1.44072 WP_001052491.1.44074 WP_001052491.1.44095 WP_001052491.1.44119 WP_001052491.1.44150 WP_001052491.1.44153 WP_001052491.1.44177 WP_001052491.1.44178 WP_001052491.1.44181 WP_001052491.1.44186 WP_001052491.1.44195 WP_001052491.1.44255 WP_001052491.1.44265 WP_001052491.1.44302 WP_001052491.1.44312 WP_001052491.1.44331 WP_001052491.1.44344 WP_001052491.1.44382 WP_001052491.1.44388 WP_001052491.1.44396 WP_001052491.1.44405 WP_001052491.1.44420 WP_001052491.1.44432 WP_001052491.1.44455 WP_001052491.1.44480 WP_001052491.1.44493 WP_001052491.1.44504 WP_001052491.1.44515 WP_001052491.1.44517 WP_001052491.1.44520 WP_001052491.1.44536 WP_001052491.1.44544 WP_001052491.1.44547 WP_001052491.1.44579 WP_001052491.1.44586 WP_001052491.1.44588 WP_001052491.1.44605 WP_001052491.1.44623 WP_001052491.1.44631 WP_001052491.1.44646 WP_001052491.1.44655 WP_001052491.1.44667 WP_001052491.1.44672 WP_001052491.1.44674 WP_001052491.1.447 WP_001052491.1.44714 WP_001052491.1.44715 WP_001052491.1.44732 WP_001052491.1.44755 WP_001052491.1.44768 WP_001052491.1.44780 WP_001052491.1.44785 WP_001052491.1.44788 WP_001052491.1.44796 WP_001052491.1.44802 WP_001052491.1.44853 WP_001052491.1.44856 WP_001052491.1.44868 WP_001052491.1.44876 WP_001052491.1.44881 WP_001052491.1.44882 WP_001052491.1.44891 WP_001052491.1.44892 WP_001052491.1.44899 WP_001052491.1.44903 WP_001052491.1.44914 WP_001052491.1.44932 WP_001052491.1.44940 WP_001052491.1.44948 WP_001052491.1.44955 WP_001052491.1.44969 WP_001052491.1.4499 WP_001052491.1.44993 WP_001052491.1.45008 WP_001052491.1.45010 WP_001052491.1.45015 WP_001052491.1.45035 WP_001052491.1.45042 WP_001052491.1.45050 WP_001052491.1.45080 WP_001052491.1.45091 WP_001052491.1.45094 WP_001052491.1.45099 WP_001052491.1.45101 WP_001052491.1.45111 WP_001052491.1.45114 WP_001052491.1.4513 WP_001052491.1.45131 WP_001052491.1.45132 WP_001052491.1.45133 WP_001052491.1.45140 WP_001052491.1.45157 WP_001052491.1.45162 WP_001052491.1.45164 WP_001052491.1.45170 WP_001052491.1.45188 WP_001052491.1.45189 WP_001052491.1.452 WP_001052491.1.45218 WP_001052491.1.45221 WP_001052491.1.45223 WP_001052491.1.45242 WP_001052491.1.45267 WP_001052491.1.4527 WP_001052491.1.45272 WP_001052491.1.45290 WP_001052491.1.45297 WP_001052491.1.453 WP_001052491.1.45303 WP_001052491.1.45321 WP_001052491.1.45332 WP_001052491.1.45364 WP_001052491.1.45419 WP_001052491.1.45431 WP_001052491.1.45439 WP_001052491.1.45447 WP_001052491.1.4545 WP_001052491.1.45450 WP_001052491.1.45456 WP_001052491.1.4546 WP_001052491.1.45472 WP_001052491.1.45492 WP_001052491.1.4550 WP_001052491.1.45507 WP_001052491.1.45542 WP_001052491.1.45555 WP_001052491.1.45560 WP_001052491.1.45574 WP_001052491.1.45577 WP_001052491.1.45586 WP_001052491.1.45610 WP_001052491.1.45620 WP_001052491.1.45640 WP_001052491.1.45645 WP_001052491.1.45654 WP_001052491.1.45670 WP_001052491.1.45698 WP_001052491.1.45703 WP_001052491.1.45705 WP_001052491.1.45713 WP_001052491.1.45730 WP_001052491.1.45734 WP_001052491.1.45747 WP_001052491.1.45763 WP_001052491.1.45768 WP_001052491.1.4577 WP_001052491.1.45771 WP_001052491.1.45773 WP_001052491.1.45780 WP_001052491.1.4580 WP_001052491.1.4582 WP_001052491.1.45833 WP_001052491.1.4584 WP_001052491.1.45852 WP_001052491.1.45859 WP_001052491.1.45862 WP_001052491.1.45870 WP_001052491.1.45874 WP_001052491.1.45875 WP_001052491.1.45878 WP_001052491.1.45881 WP_001052491.1.45888 WP_001052491.1.45897 WP_001052491.1.459 WP_001052491.1.45954 WP_001052491.1.4597 WP_001052491.1.45972 WP_001052491.1.45977 WP_001052491.1.45979 WP_001052491.1.4598 WP_001052491.1.46003 WP_001052491.1.46005 WP_001052491.1.46013 WP_001052491.1.46021 WP_001052491.1.46035 WP_001052491.1.46037 WP_001052491.1.46050 WP_001052491.1.46055 WP_001052491.1.46062 WP_001052491.1.46071 WP_001052491.1.46078 WP_001052491.1.46082 WP_001052491.1.46087 WP_001052491.1.46106 WP_001052491.1.46109 WP_001052491.1.46136 WP_001052491.1.46168 WP_001052491.1.46171 WP_001052491.1.46172 WP_001052491.1.46185 WP_001052491.1.46195 WP_001052491.1.46208 WP_001052491.1.46212 WP_001052491.1.46222 WP_001052491.1.46228 WP_001052491.1.46248 WP_001052491.1.46259 WP_001052491.1.46276 WP_001052491.1.46289 WP_001052491.1.46320 WP_001052491.1.46330 WP_001052491.1.46333 WP_001052491.1.46334 WP_001052491.1.46339 WP_001052491.1.46353 WP_001052491.1.46368 WP_001052491.1.46380 WP_001052491.1.46389 WP_001052491.1.46401 WP_001052491.1.46418 WP_001052491.1.46422 WP_001052491.1.46457 WP_001052491.1.46465 WP_001052491.1.46488 WP_001052491.1.46514 WP_001052491.1.46528 WP_001052491.1.46529 WP_001052491.1.46534 WP_001052491.1.46543 WP_001052491.1.46576 WP_001052491.1.46587 WP_001052491.1.46608 WP_001052491.1.46619 WP_001052491.1.4662 WP_001052491.1.46648 WP_001052491.1.46660 WP_001052491.1.46664 WP_001052491.1.46670 WP_001052491.1.46676 WP_001052491.1.46688 WP_001052491.1.46692 WP_001052491.1.46696 WP_001052491.1.46702 WP_001052491.1.46703 WP_001052491.1.46720 WP_001052491.1.46736 WP_001052491.1.46752 WP_001052491.1.46765 WP_001052491.1.46767 WP_001052491.1.46770 WP_001052491.1.46772 WP_001052491.1.4680 WP_001052491.1.46815 WP_001052491.1.46823 WP_001052491.1.46837 WP_001052491.1.46852 WP_001052491.1.46875 WP_001052491.1.46881 WP_001052491.1.46906 WP_001052491.1.46908 WP_001052491.1.46911 WP_001052491.1.46914 WP_001052491.1.46925 WP_001052491.1.46929 WP_001052491.1.46937 WP_001052491.1.4694 WP_001052491.1.46947 WP_001052491.1.4696 WP_001052491.1.46964 WP_001052491.1.46965 WP_001052491.1.46983 WP_001052491.1.46995 WP_001052491.1.47002 WP_001052491.1.47051 WP_001052491.1.47065 WP_001052491.1.47090 WP_001052491.1.47105 WP_001052491.1.47107 WP_001052491.1.47111 WP_001052491.1.47128 WP_001052491.1.47153 WP_001052491.1.47159 WP_001052491.1.4716 WP_001052491.1.47163 WP_001052491.1.47175 WP_001052491.1.47187 WP_001052491.1.47193 WP_001052491.1.47205 WP_001052491.1.47211 WP_001052491.1.47216 WP_001052491.1.47218 WP_001052491.1.47250 WP_001052491.1.47258 WP_001052491.1.47269 WP_001052491.1.47276 WP_001052491.1.47279 WP_001052491.1.4728 WP_001052491.1.47282 WP_001052491.1.47290 WP_001052491.1.47294 WP_001052491.1.47306 WP_001052491.1.47308 WP_001052491.1.47317 WP_001052491.1.47328 WP_001052491.1.47331 WP_001052491.1.47334 WP_001052491.1.47353 WP_001052491.1.47381 WP_001052491.1.47383 WP_001052491.1.47399 WP_001052491.1.47405 WP_001052491.1.47406 WP_001052491.1.47408 WP_001052491.1.47422 WP_001052491.1.47426 WP_001052491.1.47432 WP_001052491.1.47439 WP_001052491.1.47450 WP_001052491.1.47459 WP_001052491.1.47493 WP_001052491.1.4752 WP_001052491.1.47522 WP_001052491.1.47530 WP_001052491.1.47541 WP_001052491.1.47554 WP_001052491.1.47560 WP_001052491.1.47561 WP_001052491.1.47570 WP_001052491.1.47577 WP_001052491.1.47617 WP_001052491.1.47618 WP_001052491.1.47629 WP_001052491.1.47667 WP_001052491.1.47669 WP_001052491.1.4767 WP_001052491.1.47676 WP_001052491.1.47680 WP_001052491.1.477 WP_001052491.1.47702 WP_001052491.1.47719 WP_001052491.1.47733 WP_001052491.1.47747 WP_001052491.1.47763 WP_001052491.1.47782 WP_001052491.1.47792 WP_001052491.1.47807 WP_001052491.1.47821 WP_001052491.1.47835 WP_001052491.1.47836 WP_001052491.1.47851 WP_001052491.1.47859 WP_001052491.1.47864 WP_001052491.1.47872 WP_001052491.1.47873 WP_001052491.1.47888 WP_001052491.1.47901 WP_001052491.1.47904 WP_001052491.1.47908 WP_001052491.1.4792 WP_001052491.1.47951 WP_001052491.1.47980 WP_001052491.1.47989 WP_001052491.1.47996 WP_001052491.1.48009 WP_001052491.1.48011 WP_001052491.1.48013 WP_001052491.1.48017 WP_001052491.1.48030 WP_001052491.1.48046 WP_001052491.1.48047 WP_001052491.1.4805 WP_001052491.1.48057 WP_001052491.1.48064 WP_001052491.1.48067 WP_001052491.1.48116 WP_001052491.1.48142 WP_001052491.1.48149 WP_001052491.1.4815 WP_001052491.1.48154 WP_001052491.1.48156 WP_001052491.1.48169 WP_001052491.1.48186 WP_001052491.1.48187 WP_001052491.1.48197 WP_001052491.1.48199 WP_001052491.1.48205 WP_001052491.1.48212 WP_001052491.1.48223 WP_001052491.1.48227 WP_001052491.1.48236 WP_001052491.1.48250 WP_001052491.1.48272 WP_001052491.1.48282 WP_001052491.1.48284 WP_001052491.1.48293 WP_001052491.1.48307 WP_001052491.1.48310 WP_001052491.1.48322 WP_001052491.1.48326 WP_001052491.1.48327 WP_001052491.1.48335 WP_001052491.1.48338 WP_001052491.1.48364 WP_001052491.1.48376 WP_001052491.1.48391 WP_001052491.1.48394 WP_001052491.1.48398 WP_001052491.1.484 WP_001052491.1.4840 WP_001052491.1.48425 WP_001052491.1.48427 WP_001052491.1.48437 WP_001052491.1.48438 WP_001052491.1.48463 WP_001052491.1.48479 WP_001052491.1.48492 WP_001052491.1.4852 WP_001052491.1.48556 WP_001052491.1.48563 WP_001052491.1.48577 WP_001052491.1.48580 WP_001052491.1.48593 WP_001052491.1.48601 WP_001052491.1.48634 WP_001052491.1.48655 WP_001052491.1.48656 WP_001052491.1.48664 WP_001052491.1.48670 WP_001052491.1.4868 WP_001052491.1.48694 WP_001052491.1.48705 WP_001052491.1.48711 WP_001052491.1.48723 WP_001052491.1.48769 WP_001052491.1.48775 WP_001052491.1.48782 WP_001052491.1.48786 WP_001052491.1.48805 WP_001052491.1.48817 WP_001052491.1.48818 WP_001052491.1.48823 WP_001052491.1.48833 WP_001052491.1.48835 WP_001052491.1.4886 WP_001052491.1.48869 WP_001052491.1.48936 WP_001052491.1.48941 WP_001052491.1.48943 WP_001052491.1.48945 WP_001052491.1.48951 WP_001052491.1.48966 WP_001052491.1.48968 WP_001052491.1.48982 WP_001052491.1.48993 WP_001052491.1.48996 WP_001052491.1.4901 WP_001052491.1.49018 WP_001052491.1.49032 WP_001052491.1.4905 WP_001052491.1.49071 WP_001052491.1.49094 WP_001052491.1.49105 WP_001052491.1.49128 WP_001052491.1.49129 WP_001052491.1.49143 WP_001052491.1.49150 WP_001052491.1.49152 WP_001052491.1.49154 WP_001052491.1.49159 WP_001052491.1.4916 WP_001052491.1.49161 WP_001052491.1.49168 WP_001052491.1.4917 WP_001052491.1.49171 WP_001052491.1.49173 WP_001052491.1.4918 WP_001052491.1.49189 WP_001052491.1.49196 WP_001052491.1.49199 WP_001052491.1.4920 WP_001052491.1.49207 WP_001052491.1.4921 WP_001052491.1.49227 WP_001052491.1.49234 WP_001052491.1.4924 WP_001052491.1.49248 WP_001052491.1.49257 WP_001052491.1.49269 WP_001052491.1.49301 WP_001052491.1.49326 WP_001052491.1.49327 WP_001052491.1.49329 WP_001052491.1.49330 WP_001052491.1.49362 WP_001052491.1.49367 WP_001052491.1.49373 WP_001052491.1.49398 WP_001052491.1.49418 WP_001052491.1.49444 WP_001052491.1.4945 WP_001052491.1.49479 WP_001052491.1.49484 WP_001052491.1.4950 WP_001052491.1.49518 WP_001052491.1.49530 WP_001052491.1.49539 WP_001052491.1.49549 WP_001052491.1.49573 WP_001052491.1.49581 WP_001052491.1.49582 WP_001052491.1.496 WP_001052491.1.49603 WP_001052491.1.49605 WP_001052491.1.4962 WP_001052491.1.49643 WP_001052491.1.49653 WP_001052491.1.49658 WP_001052491.1.49669 WP_001052491.1.49671 WP_001052491.1.49672 WP_001052491.1.49690 WP_001052491.1.49704 WP_001052491.1.49707 WP_001052491.1.49715 WP_001052491.1.49728 WP_001052491.1.49730 WP_001052491.1.49732 WP_001052491.1.49742 WP_001052491.1.49745 WP_001052491.1.49757 WP_001052491.1.4980 WP_001052491.1.49800 WP_001052491.1.49819 WP_001052491.1.4982 WP_001052491.1.49825 WP_001052491.1.4984 WP_001052491.1.49860 WP_001052491.1.49863 WP_001052491.1.4987 WP_001052491.1.49871 WP_001052491.1.4989 WP_001052491.1.49894 WP_001052491.1.49907 WP_001052491.1.49912 WP_001052491.1.49913 WP_001052491.1.49917 WP_001052491.1.49918 WP_001052491.1.49921 WP_001052491.1.49934 WP_001052491.1.49935 WP_001052491.1.49936 WP_001052491.1.4994 WP_001052491.1.49943 WP_001052491.1.49951 WP_001052491.1.49970 WP_001052491.1.49982 WP_001052491.1.50013 WP_001052491.1.50015 WP_001052491.1.50023 WP_001052491.1.50028 WP_001052491.1.50038 WP_001052491.1.50039 WP_001052491.1.50061 WP_001052491.1.50064 WP_001052491.1.50071 WP_001052491.1.50076 WP_001052491.1.50117 WP_001052491.1.5013 WP_001052491.1.50138 WP_001052491.1.50145 WP_001052491.1.50175 WP_001052491.1.50178 WP_001052491.1.50192 WP_001052491.1.50212 WP_001052491.1.50217 WP_001052491.1.50219 WP_001052491.1.50229 WP_001052491.1.50261 WP_001052491.1.50291 WP_001052491.1.50313 WP_001052491.1.50314 WP_001052491.1.5035 WP_001052491.1.50356 WP_001052491.1.50360 WP_001052491.1.50367 WP_001052491.1.50369 WP_001052491.1.50377 WP_001052491.1.50388 WP_001052491.1.50424 WP_001052491.1.50425 WP_001052491.1.50430 WP_001052491.1.50431 WP_001052491.1.50440 WP_001052491.1.5045 WP_001052491.1.50462 WP_001052491.1.50464 WP_001052491.1.50477 WP_001052491.1.50516 WP_001052491.1.50525 WP_001052491.1.50527 WP_001052491.1.50536 WP_001052491.1.50543 WP_001052491.1.50555 WP_001052491.1.50556 WP_001052491.1.50558 WP_001052491.1.50568 WP_001052491.1.50578 WP_001052491.1.5059 WP_001052491.1.50594 WP_001052491.1.50595 WP_001052491.1.50647 WP_001052491.1.50660 WP_001052491.1.50669 WP_001052491.1.50699 WP_001052491.1.50711 WP_001052491.1.50740 WP_001052491.1.50742 WP_001052491.1.50745 WP_001052491.1.50748 WP_001052491.1.50759 WP_001052491.1.50768 WP_001052491.1.50799 WP_001052491.1.5080 WP_001052491.1.50817 WP_001052491.1.50820 WP_001052491.1.50827 WP_001052491.1.50829 WP_001052491.1.5087 WP_001052491.1.50884 WP_001052491.1.50896 WP_001052491.1.50937 WP_001052491.1.50958 WP_001052491.1.50962 WP_001052491.1.50974 WP_001052491.1.51008 WP_001052491.1.51015 WP_001052491.1.51031 WP_001052491.1.51062 WP_001052491.1.5108 WP_001052491.1.51085 WP_001052491.1.5109 WP_001052491.1.5110 WP_001052491.1.5111 WP_001052491.1.51130 WP_001052491.1.51133 WP_001052491.1.51138 WP_001052491.1.51152 WP_001052491.1.5117 WP_001052491.1.51194 WP_001052491.1.51209 WP_001052491.1.51220 WP_001052491.1.51226 WP_001052491.1.51236 WP_001052491.1.51245 WP_001052491.1.51250 WP_001052491.1.51271 WP_001052491.1.51277 WP_001052491.1.51282 WP_001052491.1.51295 WP_001052491.1.51306 WP_001052491.1.51310 WP_001052491.1.51326 WP_001052491.1.51346 WP_001052491.1.51365 WP_001052491.1.51376 WP_001052491.1.51377 WP_001052491.1.51393 WP_001052491.1.51403 WP_001052491.1.51418 WP_001052491.1.5145 WP_001052491.1.51454 WP_001052491.1.51456 WP_001052491.1.51465 WP_001052491.1.51469 WP_001052491.1.51492 WP_001052491.1.51496 WP_001052491.1.515 WP_001052491.1.51527 WP_001052491.1.5155 WP_001052491.1.51557 WP_001052491.1.51558 WP_001052491.1.51559 WP_001052491.1.51571 WP_001052491.1.51575 WP_001052491.1.51590 WP_001052491.1.51619 WP_001052491.1.51623 WP_001052491.1.51657 WP_001052491.1.51665 WP_001052491.1.51672 WP_001052491.1.51702 WP_001052491.1.51713 WP_001052491.1.51716 WP_001052491.1.51741 WP_001052491.1.51744 WP_001052491.1.51748 WP_001052491.1.51751 WP_001052491.1.51787 WP_001052491.1.51794 WP_001052491.1.51797 WP_001052491.1.51812 WP_001052491.1.51824 WP_001052491.1.51836 WP_001052491.1.51842 WP_001052491.1.51844 WP_001052491.1.5186 WP_001052491.1.51866 WP_001052491.1.51871 WP_001052491.1.51883 WP_001052491.1.5190 WP_001052491.1.51912 WP_001052491.1.51920 WP_001052491.1.51924 WP_001052491.1.51936 WP_001052491.1.51952 WP_001052491.1.51971 WP_001052491.1.51973 WP_001052491.1.51995 WP_001052491.1.52034 WP_001052491.1.52061 WP_001052491.1.52072 WP_001052491.1.52078 WP_001052491.1.5209 WP_001052491.1.521 WP_001052491.1.5213 WP_001052491.1.52151 WP_001052491.1.52162 WP_001052491.1.52182 WP_001052491.1.52185 WP_001052491.1.52193 WP_001052491.1.52195 WP_001052491.1.52198 WP_001052491.1.52210 WP_001052491.1.52224 WP_001052491.1.52251 WP_001052491.1.52252 WP_001052491.1.52259 WP_001052491.1.5228 WP_001052491.1.52289 WP_001052491.1.52296 WP_001052491.1.523 WP_001052491.1.52308 WP_001052491.1.5231 WP_001052491.1.52322 WP_001052491.1.52327 WP_001052491.1.52331 WP_001052491.1.52340 WP_001052491.1.52343 WP_001052491.1.52377 WP_001052491.1.52396 WP_001052491.1.52423 WP_001052491.1.52427 WP_001052491.1.52436 WP_001052491.1.52440 WP_001052491.1.52442 WP_001052491.1.52452 WP_001052491.1.52463 WP_001052491.1.52474 WP_001052491.1.5251 WP_001052491.1.52511 WP_001052491.1.52518 WP_001052491.1.52536 WP_001052491.1.52548 WP_001052491.1.52595 WP_001052491.1.52602 WP_001052491.1.52605 WP_001052491.1.52622 WP_001052491.1.52623 WP_001052491.1.52624 WP_001052491.1.52633 WP_001052491.1.52645 WP_001052491.1.52660 WP_001052491.1.52670 WP_001052491.1.52687 WP_001052491.1.52699 WP_001052491.1.52715 WP_001052491.1.52722 WP_001052491.1.52751 WP_001052491.1.52754 WP_001052491.1.52772 WP_001052491.1.52820 WP_001052491.1.52828 WP_001052491.1.52830 WP_001052491.1.52836 WP_001052491.1.52838 WP_001052491.1.52848 WP_001052491.1.52877 WP_001052491.1.52878 WP_001052491.1.52886 WP_001052491.1.52889 WP_001052491.1.52893 WP_001052491.1.52900 WP_001052491.1.52904 WP_001052491.1.52941 WP_001052491.1.52947 WP_001052491.1.52965 WP_001052491.1.52983 WP_001052491.1.52984 WP_001052491.1.52992 WP_001052491.1.53002 WP_001052491.1.53007 WP_001052491.1.53022 WP_001052491.1.5304 WP_001052491.1.53050 WP_001052491.1.53057 WP_001052491.1.53060 WP_001052491.1.53069 WP_001052491.1.53071 WP_001052491.1.53077 WP_001052491.1.53094 WP_001052491.1.53109 WP_001052491.1.53140 WP_001052491.1.53153 WP_001052491.1.53178 WP_001052491.1.53189 WP_001052491.1.5319 WP_001052491.1.53209 WP_001052491.1.5321 WP_001052491.1.5323 WP_001052491.1.53245 WP_001052491.1.53260 WP_001052491.1.53285 WP_001052491.1.53312 WP_001052491.1.53317 WP_001052491.1.53319 WP_001052491.1.53323 WP_001052491.1.53352 WP_001052491.1.5336 WP_001052491.1.53363 WP_001052491.1.53366 WP_001052491.1.53372 WP_001052491.1.53373 WP_001052491.1.53379 WP_001052491.1.53383 WP_001052491.1.53387 WP_001052491.1.53394 WP_001052491.1.53403 WP_001052491.1.53408 WP_001052491.1.53418 WP_001052491.1.53432 WP_001052491.1.53433 WP_001052491.1.53444 WP_001052491.1.53452 WP_001052491.1.53462 WP_001052491.1.53467 WP_001052491.1.5347 WP_001052491.1.53488 WP_001052491.1.53503 WP_001052491.1.53521 WP_001052491.1.53532 WP_001052491.1.53577 WP_001052491.1.5359 WP_001052491.1.53641 WP_001052491.1.53648 WP_001052491.1.53661 WP_001052491.1.53671 WP_001052491.1.53682 WP_001052491.1.53691 WP_001052491.1.53712 WP_001052491.1.53714 WP_001052491.1.53758 WP_001052491.1.53759 WP_001052491.1.53763 WP_001052491.1.53766 WP_001052491.1.53774 WP_001052491.1.53786 WP_001052491.1.53799 WP_001052491.1.5382 WP_001052491.1.53827 WP_001052491.1.53835 WP_001052491.1.53886 WP_001052491.1.53889 WP_001052491.1.53915 WP_001052491.1.53924 WP_001052491.1.53926 WP_001052491.1.53934 WP_001052491.1.53969 WP_001052491.1.53999 WP_001052491.1.5401 WP_001052491.1.54022 WP_001052491.1.54029 WP_001052491.1.54048 WP_001052491.1.54049 WP_001052491.1.54074 WP_001052491.1.54086 WP_001052491.1.54094 WP_001052491.1.54105 WP_001052491.1.54109 WP_001052491.1.54135 WP_001052491.1.54147 WP_001052491.1.54161 WP_001052491.1.54199 WP_001052491.1.54229 WP_001052491.1.54237 WP_001052491.1.54246 WP_001052491.1.54253 WP_001052491.1.54269 WP_001052491.1.54282 WP_001052491.1.54290 WP_001052491.1.54297 WP_001052491.1.54299 WP_001052491.1.54332 WP_001052491.1.54373 WP_001052491.1.54395 WP_001052491.1.544 WP_001052491.1.54404 WP_001052491.1.54413 WP_001052491.1.54426 WP_001052491.1.54438 WP_001052491.1.54446 WP_001052491.1.54471 WP_001052491.1.54477 WP_001052491.1.54479 WP_001052491.1.54485 WP_001052491.1.54491 WP_001052491.1.54503 WP_001052491.1.54510 WP_001052491.1.54518 WP_001052491.1.54539 WP_001052491.1.54543 WP_001052491.1.54551 WP_001052491.1.54554 WP_001052491.1.54572 WP_001052491.1.54574 WP_001052491.1.54637 WP_001052491.1.54675 WP_001052491.1.54689 WP_001052491.1.5469 WP_001052491.1.54733 WP_001052491.1.54744 WP_001052491.1.54745 WP_001052491.1.54753 WP_001052491.1.54819 WP_001052491.1.54826 WP_001052491.1.54830 WP_001052491.1.54847 WP_001052491.1.54851 WP_001052491.1.54878 WP_001052491.1.54895 WP_001052491.1.54914 WP_001052491.1.54929 WP_001052491.1.54931 WP_001052491.1.54955 WP_001052491.1.54967 WP_001052491.1.54990 WP_001052491.1.54995 WP_001052491.1.5500 WP_001052491.1.55004 WP_001052491.1.55014 WP_001052491.1.55058 WP_001052491.1.55082 WP_001052491.1.55084 WP_001052491.1.55090 WP_001052491.1.55095 WP_001052491.1.55100 WP_001052491.1.55139 WP_001052491.1.5519 WP_001052491.1.55192 WP_001052491.1.552 WP_001052491.1.55214 WP_001052491.1.55220 WP_001052491.1.55239 WP_001052491.1.55271 WP_001052491.1.55272 WP_001052491.1.55274 WP_001052491.1.55301 WP_001052491.1.55306 WP_001052491.1.55309 WP_001052491.1.55327 WP_001052491.1.55336 WP_001052491.1.55352 WP_001052491.1.5536 WP_001052491.1.55367 WP_001052491.1.55369 WP_001052491.1.55403 WP_001052491.1.55405 WP_001052491.1.55419 WP_001052491.1.55421 WP_001052491.1.55442 WP_001052491.1.55495 WP_001052491.1.5550 WP_001052491.1.55508 WP_001052491.1.55527 WP_001052491.1.55535 WP_001052491.1.55538 WP_001052491.1.5554 WP_001052491.1.55544 WP_001052491.1.55558 WP_001052491.1.5556 WP_001052491.1.55573 WP_001052491.1.55583 WP_001052491.1.5559 WP_001052491.1.55603 WP_001052491.1.5562 WP_001052491.1.55620 WP_001052491.1.55628 WP_001052491.1.55637 WP_001052491.1.5565 WP_001052491.1.55653 WP_001052491.1.55657 WP_001052491.1.557 WP_001052491.1.55717 WP_001052491.1.55719 WP_001052491.1.55724 WP_001052491.1.55728 WP_001052491.1.55746 WP_001052491.1.5575 WP_001052491.1.55784 WP_001052491.1.55786 WP_001052491.1.5580 WP_001052491.1.55818 WP_001052491.1.55831 WP_001052491.1.55835 WP_001052491.1.55839 WP_001052491.1.55845 WP_001052491.1.55848 WP_001052491.1.55854 WP_001052491.1.55859 WP_001052491.1.55867 WP_001052491.1.55874 WP_001052491.1.55886 WP_001052491.1.5589 WP_001052491.1.5590 WP_001052491.1.55904 WP_001052491.1.55916 WP_001052491.1.55933 WP_001052491.1.55941 WP_001052491.1.55949 WP_001052491.1.55953 WP_001052491.1.55955 WP_001052491.1.55960 WP_001052491.1.55991 WP_001052491.1.56000 WP_001052491.1.56003 WP_001052491.1.56025 WP_001052491.1.56039 WP_001052491.1.5604 WP_001052491.1.56048 WP_001052491.1.5606 WP_001052491.1.56064 WP_001052491.1.56078 WP_001052491.1.56098 WP_001052491.1.56099 WP_001052491.1.56106 WP_001052491.1.56135 WP_001052491.1.56153 WP_001052491.1.56159 WP_001052491.1.56200 WP_001052491.1.56210 WP_001052491.1.56213 WP_001052491.1.56214 WP_001052491.1.56220 WP_001052491.1.56225 WP_001052491.1.5623 WP_001052491.1.56237 WP_001052491.1.56239 WP_001052491.1.56241 WP_001052491.1.56242 WP_001052491.1.56260 WP_001052491.1.56265 WP_001052491.1.56272 WP_001052491.1.56275 WP_001052491.1.56281 WP_001052491.1.56306 WP_001052491.1.56332 WP_001052491.1.56333 WP_001052491.1.56343 WP_001052491.1.5635 WP_001052491.1.56364 WP_001052491.1.5637 WP_001052491.1.56377 WP_001052491.1.56387 WP_001052491.1.56400 WP_001052491.1.5644 WP_001052491.1.56444 WP_001052491.1.56453 WP_001052491.1.56464 WP_001052491.1.56482 WP_001052491.1.56496 WP_001052491.1.56522 WP_001052491.1.56525 WP_001052491.1.56527 WP_001052491.1.56530 WP_001052491.1.56542 WP_001052491.1.56558 WP_001052491.1.56570 WP_001052491.1.5658 WP_001052491.1.56584 WP_001052491.1.56598 WP_001052491.1.566 WP_001052491.1.56608 WP_001052491.1.56619 WP_001052491.1.56628 WP_001052491.1.56641 WP_001052491.1.5665 WP_001052491.1.56658 WP_001052491.1.5666 WP_001052491.1.56679 WP_001052491.1.56696 WP_001052491.1.56702 WP_001052491.1.56708 WP_001052491.1.56722 WP_001052491.1.56723 WP_001052491.1.56737 WP_001052491.1.5675 WP_001052491.1.56767 WP_001052491.1.5677 WP_001052491.1.56772 WP_001052491.1.56778 WP_001052491.1.56779 WP_001052491.1.56794 WP_001052491.1.56803 WP_001052491.1.56806 WP_001052491.1.56815 WP_001052491.1.56822 WP_001052491.1.56856 WP_001052491.1.5686 WP_001052491.1.56865 WP_001052491.1.56878 WP_001052491.1.569 WP_001052491.1.56903 WP_001052491.1.56931 WP_001052491.1.56966 WP_001052491.1.56967 WP_001052491.1.56975 WP_001052491.1.56986 WP_001052491.1.57015 WP_001052491.1.57024 WP_001052491.1.57047 WP_001052491.1.5705 WP_001052491.1.57073 WP_001052491.1.57075 WP_001052491.1.57080 WP_001052491.1.57081 WP_001052491.1.57097 WP_001052491.1.57102 WP_001052491.1.57109 WP_001052491.1.57115 WP_001052491.1.57141 WP_001052491.1.57158 WP_001052491.1.57170 WP_001052491.1.57175 WP_001052491.1.5718 WP_001052491.1.57190 WP_001052491.1.57196 WP_001052491.1.57214 WP_001052491.1.57223 WP_001052491.1.57265 WP_001052491.1.57271 WP_001052491.1.57291 WP_001052491.1.57309 WP_001052491.1.57316 WP_001052491.1.57330 WP_001052491.1.57338 WP_001052491.1.5735 WP_001052491.1.57370 WP_001052491.1.57376 WP_001052491.1.57385 WP_001052491.1.57389 WP_001052491.1.57427 WP_001052491.1.5743 WP_001052491.1.57445 WP_001052491.1.57448 WP_001052491.1.57459 WP_001052491.1.57481 WP_001052491.1.5749 WP_001052491.1.57507 WP_001052491.1.5752 WP_001052491.1.57537 WP_001052491.1.57577 WP_001052491.1.57593 WP_001052491.1.57594 WP_001052491.1.57612 WP_001052491.1.5763 WP_001052491.1.57635 WP_001052491.1.57650 WP_001052491.1.57665 WP_001052491.1.57670 WP_001052491.1.57682 WP_001052491.1.57692 WP_001052491.1.57693 WP_001052491.1.5770 WP_001052491.1.57701 WP_001052491.1.57718 WP_001052491.1.57720 WP_001052491.1.57723 WP_001052491.1.57727 WP_001052491.1.57730 WP_001052491.1.57734 WP_001052491.1.57745 WP_001052491.1.57754 WP_001052491.1.57761 WP_001052491.1.57770 WP_001052491.1.57783 WP_001052491.1.57786 WP_001052491.1.57808 WP_001052491.1.57819 WP_001052491.1.57837 WP_001052491.1.57840 WP_001052491.1.57844 WP_001052491.1.57861 WP_001052491.1.57875 WP_001052491.1.57878 WP_001052491.1.57883 WP_001052491.1.57888 WP_001052491.1.579 WP_001052491.1.5791 WP_001052491.1.57910 WP_001052491.1.57915 WP_001052491.1.57928 WP_001052491.1.57943 WP_001052491.1.57944 WP_001052491.1.57952 WP_001052491.1.57962 WP_001052491.1.57974 WP_001052491.1.5799 WP_001052491.1.58005 WP_001052491.1.58006 WP_001052491.1.58014 WP_001052491.1.58016 WP_001052491.1.58017 WP_001052491.1.58035 WP_001052491.1.58042 WP_001052491.1.58049 WP_001052491.1.58050 WP_001052491.1.58051 WP_001052491.1.58074 WP_001052491.1.58106 WP_001052491.1.58116 WP_001052491.1.58122 WP_001052491.1.58127 WP_001052491.1.58139 WP_001052491.1.58148 WP_001052491.1.58158 WP_001052491.1.5816 WP_001052491.1.5817 WP_001052491.1.58175 WP_001052491.1.58185 WP_001052491.1.58198 WP_001052491.1.58212 WP_001052491.1.58241 WP_001052491.1.58242 WP_001052491.1.58246 WP_001052491.1.5827 WP_001052491.1.58277 WP_001052491.1.58317 WP_001052491.1.5832 WP_001052491.1.58321 WP_001052491.1.58325 WP_001052491.1.58350 WP_001052491.1.58352 WP_001052491.1.58353 WP_001052491.1.58364 WP_001052491.1.58366 WP_001052491.1.58373 WP_001052491.1.58388 WP_001052491.1.58392 WP_001052491.1.58395 WP_001052491.1.58413 WP_001052491.1.58419 WP_001052491.1.58421 WP_001052491.1.58430 WP_001052491.1.58435 WP_001052491.1.58473 WP_001052491.1.58481 WP_001052491.1.5849 WP_001052491.1.58495 WP_001052491.1.58497 WP_001052491.1.58504 WP_001052491.1.58508 WP_001052491.1.58512 WP_001052491.1.58521 WP_001052491.1.58530 WP_001052491.1.58538 WP_001052491.1.58549 WP_001052491.1.5857 WP_001052491.1.58571 WP_001052491.1.58584 WP_001052491.1.58588 WP_001052491.1.58592 WP_001052491.1.58598 WP_001052491.1.586 WP_001052491.1.58603 WP_001052491.1.58626 WP_001052491.1.58686 WP_001052491.1.58701 WP_001052491.1.58704 WP_001052491.1.58714 WP_001052491.1.58718 WP_001052491.1.58735 WP_001052491.1.58760 WP_001052491.1.58763 WP_001052491.1.58772 WP_001052491.1.58775 WP_001052491.1.58798 WP_001052491.1.5880 WP_001052491.1.58833 WP_001052491.1.58839 WP_001052491.1.58855 WP_001052491.1.58860 WP_001052491.1.58934 WP_001052491.1.58936 WP_001052491.1.58960 WP_001052491.1.58981 WP_001052491.1.58991 WP_001052491.1.58998 WP_001052491.1.5901 WP_001052491.1.59011 WP_001052491.1.59014 WP_001052491.1.59039 WP_001052491.1.5904 WP_001052491.1.59046 WP_001052491.1.59062 WP_001052491.1.59077 WP_001052491.1.59098 WP_001052491.1.59124 WP_001052491.1.59133 WP_001052491.1.59135 WP_001052491.1.59146 WP_001052491.1.59157 WP_001052491.1.59175 WP_001052491.1.59178 WP_001052491.1.59187 WP_001052491.1.5920 WP_001052491.1.59203 WP_001052491.1.59213 WP_001052491.1.5925 WP_001052491.1.59269 WP_001052491.1.59284 WP_001052491.1.5930 WP_001052491.1.59311 WP_001052491.1.59327 WP_001052491.1.59329 WP_001052491.1.59334 WP_001052491.1.59337 WP_001052491.1.59363 WP_001052491.1.5938 WP_001052491.1.59380 WP_001052491.1.59397 WP_001052491.1.59398 WP_001052491.1.5940 WP_001052491.1.59401 WP_001052491.1.59404 WP_001052491.1.59414 WP_001052491.1.59441 WP_001052491.1.59457 WP_001052491.1.59459 WP_001052491.1.59462 WP_001052491.1.59464 WP_001052491.1.59467 WP_001052491.1.59478 WP_001052491.1.59489 WP_001052491.1.59498 WP_001052491.1.59540 WP_001052491.1.59546 WP_001052491.1.59547 WP_001052491.1.59567 WP_001052491.1.59594 WP_001052491.1.59598 WP_001052491.1.59603 WP_001052491.1.59609 WP_001052491.1.59624 WP_001052491.1.59629 WP_001052491.1.59643 WP_001052491.1.59663 WP_001052491.1.59668 WP_001052491.1.59669 WP_001052491.1.59671 WP_001052491.1.59697 WP_001052491.1.5972 WP_001052491.1.59736 WP_001052491.1.59787 WP_001052491.1.59803 WP_001052491.1.59810 WP_001052491.1.59819 WP_001052491.1.5982 WP_001052491.1.59822 WP_001052491.1.59864 WP_001052491.1.59874 WP_001052491.1.59881 WP_001052491.1.59886 WP_001052491.1.59896 WP_001052491.1.59907 WP_001052491.1.59915 WP_001052491.1.59921 WP_001052491.1.59945 WP_001052491.1.59977 WP_001052491.1.60001 WP_001052491.1.60006 WP_001052491.1.60022 WP_001052491.1.6006 WP_001052491.1.60086 WP_001052491.1.60101 WP_001052491.1.60107 WP_001052491.1.6011 WP_001052491.1.60118 WP_001052491.1.60123 WP_001052491.1.60124 WP_001052491.1.60147 WP_001052491.1.60149 WP_001052491.1.60156 WP_001052491.1.60157 WP_001052491.1.60158 WP_001052491.1.60165 WP_001052491.1.6017 WP_001052491.1.60181 WP_001052491.1.602 WP_001052491.1.60201 WP_001052491.1.60227 WP_001052491.1.60251 WP_001052491.1.60259 WP_001052491.1.60280 WP_001052491.1.60289 WP_001052491.1.60302 WP_001052491.1.60307 WP_001052491.1.60339 WP_001052491.1.6034 WP_001052491.1.60345 WP_001052491.1.60353 WP_001052491.1.60355 WP_001052491.1.60360 WP_001052491.1.60368 WP_001052491.1.60382 WP_001052491.1.60414 WP_001052491.1.60431 WP_001052491.1.60434 WP_001052491.1.6045 WP_001052491.1.60462 WP_001052491.1.60473 WP_001052491.1.60489 WP_001052491.1.60492 WP_001052491.1.60493 WP_001052491.1.60515 WP_001052491.1.60530 WP_001052491.1.60547 WP_001052491.1.60551 WP_001052491.1.60585 WP_001052491.1.60594 WP_001052491.1.60595 WP_001052491.1.60636 WP_001052491.1.60641 WP_001052491.1.60675 WP_001052491.1.60677 WP_001052491.1.60690 WP_001052491.1.60696 WP_001052491.1.60704 WP_001052491.1.60719 WP_001052491.1.60730 WP_001052491.1.60734 WP_001052491.1.60742 WP_001052491.1.60750 WP_001052491.1.60751 WP_001052491.1.60758 WP_001052491.1.60759 WP_001052491.1.60765 WP_001052491.1.60778 WP_001052491.1.60787 WP_001052491.1.60813 WP_001052491.1.60820 WP_001052491.1.60845 WP_001052491.1.6085 WP_001052491.1.60859 WP_001052491.1.60869 WP_001052491.1.60888 WP_001052491.1.60898 WP_001052491.1.60912 WP_001052491.1.60917 WP_001052491.1.60923 WP_001052491.1.60934 WP_001052491.1.60943 WP_001052491.1.60946 WP_001052491.1.60948 WP_001052491.1.60949 WP_001052491.1.60965 WP_001052491.1.60981 WP_001052491.1.60982 WP_001052491.1.60991 WP_001052491.1.61009 WP_001052491.1.61013 WP_001052491.1.61019 WP_001052491.1.61023 WP_001052491.1.61026 WP_001052491.1.61029 WP_001052491.1.61030 WP_001052491.1.61031 WP_001052491.1.61077 WP_001052491.1.61082 WP_001052491.1.61107 WP_001052491.1.61115 WP_001052491.1.61119 WP_001052491.1.61139 WP_001052491.1.61152 WP_001052491.1.61153 WP_001052491.1.6118 WP_001052491.1.61187 WP_001052491.1.61188 WP_001052491.1.61189 WP_001052491.1.6119 WP_001052491.1.61215 WP_001052491.1.61224 WP_001052491.1.6123 WP_001052491.1.61257 WP_001052491.1.61261 WP_001052491.1.61263 WP_001052491.1.61271 WP_001052491.1.61277 WP_001052491.1.61286 WP_001052491.1.61289 WP_001052491.1.61313 WP_001052491.1.61316 WP_001052491.1.61318 WP_001052491.1.61324 WP_001052491.1.61327 WP_001052491.1.61339 WP_001052491.1.61346 WP_001052491.1.61353 WP_001052491.1.61354 WP_001052491.1.6136 WP_001052491.1.61375 WP_001052491.1.61393 WP_001052491.1.61394 WP_001052491.1.61408 WP_001052491.1.61413 WP_001052491.1.61421 WP_001052491.1.61430 WP_001052491.1.61439 WP_001052491.1.61440 WP_001052491.1.6149 WP_001052491.1.61515 WP_001052491.1.61534 WP_001052491.1.61547 WP_001052491.1.61555 WP_001052491.1.61564 WP_001052491.1.61585 WP_001052491.1.61591 WP_001052491.1.61597 WP_001052491.1.61615 WP_001052491.1.61639 WP_001052491.1.61641 WP_001052491.1.61653 WP_001052491.1.6166 WP_001052491.1.6168 WP_001052491.1.61687 WP_001052491.1.6170 WP_001052491.1.61705 WP_001052491.1.61709 WP_001052491.1.61713 WP_001052491.1.61747 WP_001052491.1.61749 WP_001052491.1.61776 WP_001052491.1.61784 WP_001052491.1.61800 WP_001052491.1.61802 WP_001052491.1.61831 WP_001052491.1.61838 WP_001052491.1.61843 WP_001052491.1.61864 WP_001052491.1.6188 WP_001052491.1.6189 WP_001052491.1.61897 WP_001052491.1.61899 WP_001052491.1.619 WP_001052491.1.61903 WP_001052491.1.61910 WP_001052491.1.61921 WP_001052491.1.61936 WP_001052491.1.61962 WP_001052491.1.61970 WP_001052491.1.61975 WP_001052491.1.61976 WP_001052491.1.61978 WP_001052491.1.62002 WP_001052491.1.6201 WP_001052491.1.62028 WP_001052491.1.62030 WP_001052491.1.62069 WP_001052491.1.62071 WP_001052491.1.6208 WP_001052491.1.62084 WP_001052491.1.62085 WP_001052491.1.62088 WP_001052491.1.62093 WP_001052491.1.62096 WP_001052491.1.62127 WP_001052491.1.62140 WP_001052491.1.62160 WP_001052491.1.62164 WP_001052491.1.62229 WP_001052491.1.62247 WP_001052491.1.62253 WP_001052491.1.62254 WP_001052491.1.62265 WP_001052491.1.62318 WP_001052491.1.6234 WP_001052491.1.62346 WP_001052491.1.62352 WP_001052491.1.62367 WP_001052491.1.62382 WP_001052491.1.62383 WP_001052491.1.62392 WP_001052491.1.62398 WP_001052491.1.62409 WP_001052491.1.62414 WP_001052491.1.62416 WP_001052491.1.62429 WP_001052491.1.62437 WP_001052491.1.62453 WP_001052491.1.62459 WP_001052491.1.62462 WP_001052491.1.62474 WP_001052491.1.62482 WP_001052491.1.62492 WP_001052491.1.62496 WP_001052491.1.6250 WP_001052491.1.62537 WP_001052491.1.62539 WP_001052491.1.62553 WP_001052491.1.62563 WP_001052491.1.62575 WP_001052491.1.62602 WP_001052491.1.62608 WP_001052491.1.62621 WP_001052491.1.62625 WP_001052491.1.62630 WP_001052491.1.62653 WP_001052491.1.6266 WP_001052491.1.62671 WP_001052491.1.62674 WP_001052491.1.6268 WP_001052491.1.62684 WP_001052491.1.62685 WP_001052491.1.62723 WP_001052491.1.62740 WP_001052491.1.62756 WP_001052491.1.62764 WP_001052491.1.62771 WP_001052491.1.62781 WP_001052491.1.62796 WP_001052491.1.62808 WP_001052491.1.62822 WP_001052491.1.62824 WP_001052491.1.62829 WP_001052491.1.62831 WP_001052491.1.62842 WP_001052491.1.62860 WP_001052491.1.62863 WP_001052491.1.62878 WP_001052491.1.62880 WP_001052491.1.62925 WP_001052491.1.62927 WP_001052491.1.62956 WP_001052491.1.62970 WP_001052491.1.62974 WP_001052491.1.6298 WP_001052491.1.62998 WP_001052491.1.63003 WP_001052491.1.63004 WP_001052491.1.63011 WP_001052491.1.63021 WP_001052491.1.63027 WP_001052491.1.63040 WP_001052491.1.63047 WP_001052491.1.63050 WP_001052491.1.63051 WP_001052491.1.63052 WP_001052491.1.63062 WP_001052491.1.63068 WP_001052491.1.63070 WP_001052491.1.63083 WP_001052491.1.63085 WP_001052491.1.631 WP_001052491.1.63107 WP_001052491.1.63120 WP_001052491.1.63131 WP_001052491.1.63132 WP_001052491.1.63139 WP_001052491.1.63140 WP_001052491.1.63142 WP_001052491.1.63143 WP_001052491.1.63162 WP_001052491.1.63170 WP_001052491.1.63182 WP_001052491.1.63190 WP_001052491.1.63195 WP_001052491.1.63215 WP_001052491.1.63220 WP_001052491.1.63228 WP_001052491.1.63233 WP_001052491.1.63244 WP_001052491.1.63255 WP_001052491.1.63273 WP_001052491.1.63279 WP_001052491.1.63280 WP_001052491.1.63288 WP_001052491.1.63289 WP_001052491.1.63296 WP_001052491.1.63304 WP_001052491.1.63307 WP_001052491.1.63313 WP_001052491.1.63319 WP_001052491.1.63322 WP_001052491.1.63324 WP_001052491.1.63333 WP_001052491.1.63335 WP_001052491.1.63337 WP_001052491.1.63341 WP_001052491.1.63364 WP_001052491.1.63365 WP_001052491.1.63383 WP_001052491.1.634 WP_001052491.1.63406 WP_001052491.1.63411 WP_001052491.1.63421 WP_001052491.1.63441 WP_001052491.1.63460 WP_001052491.1.63469 WP_001052491.1.63471 WP_001052491.1.63510 WP_001052491.1.63527 WP_001052491.1.63540 WP_001052491.1.6355 WP_001052491.1.63565 WP_001052491.1.63589 WP_001052491.1.63617 WP_001052491.1.63635 WP_001052491.1.63672 WP_001052491.1.63673 WP_001052491.1.63678 WP_001052491.1.63693 WP_001052491.1.63704 WP_001052491.1.63705 WP_001052491.1.63726 WP_001052491.1.63729 WP_001052491.1.6374 WP_001052491.1.63751 WP_001052491.1.63759 WP_001052491.1.63760 WP_001052491.1.63763 WP_001052491.1.63774 WP_001052491.1.6378 WP_001052491.1.63828 WP_001052491.1.63847 WP_001052491.1.6387 WP_001052491.1.63874 WP_001052491.1.6388 WP_001052491.1.63890 WP_001052491.1.63894 WP_001052491.1.63895 WP_001052491.1.63907 WP_001052491.1.63910 WP_001052491.1.63923 WP_001052491.1.63937 WP_001052491.1.63947 WP_001052491.1.63975 WP_001052491.1.63978 WP_001052491.1.63987 WP_001052491.1.63998 WP_001052491.1.64012 WP_001052491.1.6403 WP_001052491.1.64060 WP_001052491.1.64079 WP_001052491.1.6408 WP_001052491.1.64094 WP_001052491.1.64105 WP_001052491.1.64108 WP_001052491.1.6412 WP_001052491.1.64127 WP_001052491.1.64181 WP_001052491.1.64192 WP_001052491.1.642 WP_001052491.1.64207 WP_001052491.1.64230 WP_001052491.1.64232 WP_001052491.1.64234 WP_001052491.1.64250 WP_001052491.1.64251 WP_001052491.1.64279 WP_001052491.1.64288 WP_001052491.1.64303 WP_001052491.1.64304 WP_001052491.1.64334 WP_001052491.1.64351 WP_001052491.1.64367 WP_001052491.1.64368 WP_001052491.1.6438 WP_001052491.1.64396 WP_001052491.1.64397 WP_001052491.1.64400 WP_001052491.1.64408 WP_001052491.1.64434 WP_001052491.1.64440 WP_001052491.1.64446 WP_001052491.1.64456 WP_001052491.1.64457 WP_001052491.1.64473 WP_001052491.1.6448 WP_001052491.1.645 WP_001052491.1.64525 WP_001052491.1.6453 WP_001052491.1.64537 WP_001052491.1.64549 WP_001052491.1.64565 WP_001052491.1.64583 WP_001052491.1.6459 WP_001052491.1.64598 WP_001052491.1.6462 WP_001052491.1.64628 WP_001052491.1.64630 WP_001052491.1.64631 WP_001052491.1.64643 WP_001052491.1.64665 WP_001052491.1.64677 WP_001052491.1.64686 WP_001052491.1.64720 WP_001052491.1.64765 WP_001052491.1.6479 WP_001052491.1.64811 WP_001052491.1.64845 WP_001052491.1.64858 WP_001052491.1.64860 WP_001052491.1.64873 WP_001052491.1.64879 WP_001052491.1.6488 WP_001052491.1.64893 WP_001052491.1.64896 WP_001052491.1.64897 WP_001052491.1.64911 WP_001052491.1.64928 WP_001052491.1.64935 WP_001052491.1.64951 WP_001052491.1.64956 WP_001052491.1.64961 WP_001052491.1.64988 WP_001052491.1.64994 WP_001052491.1.64996 WP_001052491.1.64998 WP_001052491.1.65025 WP_001052491.1.65033 WP_001052491.1.65038 WP_001052491.1.65044 WP_001052491.1.65046 WP_001052491.1.65076 WP_001052491.1.65082 WP_001052491.1.6509 WP_001052491.1.65125 WP_001052491.1.65132 WP_001052491.1.65153 WP_001052491.1.65156 WP_001052491.1.65158 WP_001052491.1.65164 WP_001052491.1.65180 WP_001052491.1.65193 WP_001052491.1.65201 WP_001052491.1.65203 WP_001052491.1.65214 WP_001052491.1.65217 WP_001052491.1.65233 WP_001052491.1.65243 WP_001052491.1.65259 WP_001052491.1.65262 WP_001052491.1.65264 WP_001052491.1.65274 WP_001052491.1.6531 WP_001052491.1.65317 WP_001052491.1.65346 WP_001052491.1.65358 WP_001052491.1.65361 WP_001052491.1.65367 WP_001052491.1.65387 WP_001052491.1.65406 WP_001052491.1.65407 WP_001052491.1.65419 WP_001052491.1.65423 WP_001052491.1.65432 WP_001052491.1.6544 WP_001052491.1.65443 WP_001052491.1.65448 WP_001052491.1.65451 WP_001052491.1.6547 WP_001052491.1.65470 WP_001052491.1.65504 WP_001052491.1.6551 WP_001052491.1.65512 WP_001052491.1.65520 WP_001052491.1.65541 WP_001052491.1.65544 WP_001052491.1.65555 WP_001052491.1.65562 WP_001052491.1.65585 WP_001052491.1.6559 WP_001052491.1.65599 WP_001052491.1.65600 WP_001052491.1.65616 WP_001052491.1.65629 WP_001052491.1.65643 WP_001052491.1.65653 WP_001052491.1.65656 WP_001052491.1.65663 WP_001052491.1.65675 WP_001052491.1.6568 WP_001052491.1.65689 WP_001052491.1.65693 WP_001052491.1.65700 WP_001052491.1.65703 WP_001052491.1.65704 WP_001052491.1.65705 WP_001052491.1.65713 WP_001052491.1.65717 WP_001052491.1.65734 WP_001052491.1.65750 WP_001052491.1.65752 WP_001052491.1.65769 WP_001052491.1.6578 WP_001052491.1.65808 WP_001052491.1.65809 WP_001052491.1.6583 WP_001052491.1.65842 WP_001052491.1.6585 WP_001052491.1.65856 WP_001052491.1.65870 WP_001052491.1.65879 WP_001052491.1.65886 WP_001052491.1.65892 WP_001052491.1.65922 WP_001052491.1.65928 WP_001052491.1.65930 WP_001052491.1.65931 WP_001052491.1.65935 WP_001052491.1.65946 WP_001052491.1.65947 WP_001052491.1.65948 WP_001052491.1.65965 WP_001052491.1.65986 WP_001052491.1.65990 WP_001052491.1.66009 WP_001052491.1.66014 WP_001052491.1.6603 WP_001052491.1.66035 WP_001052491.1.66054 WP_001052491.1.66069 WP_001052491.1.66073 WP_001052491.1.66081 WP_001052491.1.661 WP_001052491.1.6612 WP_001052491.1.66120 WP_001052491.1.66130 WP_001052491.1.66133 WP_001052491.1.66144 WP_001052491.1.66175 WP_001052491.1.66227 WP_001052491.1.66262 WP_001052491.1.66265 WP_001052491.1.66281 WP_001052491.1.66287 WP_001052491.1.66298 WP_001052491.1.66302 WP_001052491.1.6632 WP_001052491.1.66322 WP_001052491.1.66328 WP_001052491.1.66366 WP_001052491.1.66369 WP_001052491.1.66433 WP_001052491.1.66453 WP_001052491.1.66482 WP_001052491.1.66505 WP_001052491.1.66513 WP_001052491.1.66518 WP_001052491.1.66519 WP_001052491.1.66542 WP_001052491.1.66554 WP_001052491.1.66556 WP_001052491.1.66564 WP_001052491.1.66576 WP_001052491.1.66588 WP_001052491.1.66598 WP_001052491.1.66601 WP_001052491.1.66606 WP_001052491.1.66611 WP_001052491.1.6662 WP_001052491.1.66628 WP_001052491.1.66645 WP_001052491.1.66655 WP_001052491.1.66664 WP_001052491.1.66677 WP_001052491.1.6668 WP_001052491.1.66690 WP_001052491.1.66705 WP_001052491.1.66711 WP_001052491.1.66712 WP_001052491.1.66726 WP_001052491.1.6674 WP_001052491.1.66756 WP_001052491.1.66765 WP_001052491.1.66766 WP_001052491.1.66786 WP_001052491.1.66792 WP_001052491.1.66803 WP_001052491.1.66816 WP_001052491.1.66818 WP_001052491.1.6684 WP_001052491.1.66853 WP_001052491.1.66879 WP_001052491.1.6688 WP_001052491.1.66904 WP_001052491.1.66906 WP_001052491.1.66938 WP_001052491.1.66969 WP_001052491.1.66979 WP_001052491.1.66996 WP_001052491.1.6700 WP_001052491.1.67006 WP_001052491.1.67012 WP_001052491.1.67014 WP_001052491.1.67016 WP_001052491.1.67063 WP_001052491.1.67067 WP_001052491.1.67072 WP_001052491.1.67090 WP_001052491.1.67112 WP_001052491.1.67113 WP_001052491.1.67135 WP_001052491.1.67147 WP_001052491.1.67152 WP_001052491.1.67155 WP_001052491.1.67160 WP_001052491.1.67161 WP_001052491.1.67191 WP_001052491.1.67204 WP_001052491.1.67212 WP_001052491.1.6722 WP_001052491.1.67238 WP_001052491.1.67251 WP_001052491.1.67259 WP_001052491.1.6726 WP_001052491.1.67266 WP_001052491.1.67286 WP_001052491.1.67294 WP_001052491.1.67296 WP_001052491.1.67297 WP_001052491.1.67312 WP_001052491.1.67328 WP_001052491.1.67329 WP_001052491.1.67333 WP_001052491.1.67375 WP_001052491.1.67379 WP_001052491.1.67386 WP_001052491.1.6740 WP_001052491.1.67414 WP_001052491.1.67418 WP_001052491.1.67420 WP_001052491.1.67425 WP_001052491.1.67447 WP_001052491.1.67457 WP_001052491.1.67460 WP_001052491.1.67463 WP_001052491.1.67480 WP_001052491.1.67505 WP_001052491.1.67507 WP_001052491.1.67513 WP_001052491.1.67520 WP_001052491.1.67521 WP_001052491.1.67540 WP_001052491.1.67554 WP_001052491.1.67571 WP_001052491.1.67572 WP_001052491.1.67609 WP_001052491.1.67612 WP_001052491.1.67618 WP_001052491.1.67620 WP_001052491.1.67621 WP_001052491.1.67644 WP_001052491.1.67651 WP_001052491.1.67652 WP_001052491.1.67653 WP_001052491.1.67691 WP_001052491.1.67703 WP_001052491.1.67712 WP_001052491.1.67713 WP_001052491.1.67722 WP_001052491.1.67752 WP_001052491.1.67754 WP_001052491.1.67762 WP_001052491.1.67767 WP_001052491.1.67798 WP_001052491.1.67800 WP_001052491.1.67806 WP_001052491.1.67808 WP_001052491.1.67815 WP_001052491.1.67834 WP_001052491.1.6786 WP_001052491.1.67864 WP_001052491.1.67865 WP_001052491.1.67867 WP_001052491.1.67880 WP_001052491.1.67900 WP_001052491.1.67925 WP_001052491.1.67931 WP_001052491.1.67941 WP_001052491.1.67986 WP_001052491.1.67991 WP_001052491.1.68001 WP_001052491.1.68020 WP_001052491.1.68033 WP_001052491.1.68054 WP_001052491.1.68066 WP_001052491.1.68101 WP_001052491.1.68102 WP_001052491.1.6811 WP_001052491.1.68111 WP_001052491.1.68134 WP_001052491.1.68139 WP_001052491.1.68141 WP_001052491.1.68152 WP_001052491.1.68160 WP_001052491.1.68161 WP_001052491.1.68199 WP_001052491.1.68202 WP_001052491.1.68219 WP_001052491.1.68221 WP_001052491.1.68223 WP_001052491.1.68233 WP_001052491.1.6824 WP_001052491.1.68261 WP_001052491.1.68268 WP_001052491.1.68286 WP_001052491.1.68295 WP_001052491.1.68296 WP_001052491.1.68299 WP_001052491.1.6830 WP_001052491.1.68307 WP_001052491.1.68334 WP_001052491.1.6834 WP_001052491.1.68343 WP_001052491.1.68351 WP_001052491.1.68355 WP_001052491.1.68366 WP_001052491.1.68367 WP_001052491.1.6839 WP_001052491.1.68392 WP_001052491.1.68397 WP_001052491.1.68398 WP_001052491.1.68399 WP_001052491.1.68404 WP_001052491.1.68416 WP_001052491.1.68425 WP_001052491.1.68466 WP_001052491.1.68470 WP_001052491.1.68476 WP_001052491.1.68479 WP_001052491.1.68483 WP_001052491.1.68489 WP_001052491.1.68504 WP_001052491.1.68505 WP_001052491.1.68512 WP_001052491.1.68522 WP_001052491.1.68542 WP_001052491.1.68548 WP_001052491.1.68565 WP_001052491.1.68575 WP_001052491.1.68636 WP_001052491.1.68650 WP_001052491.1.68657 WP_001052491.1.68681 WP_001052491.1.68683 WP_001052491.1.68699 WP_001052491.1.68703 WP_001052491.1.68716 WP_001052491.1.68728 WP_001052491.1.68737 WP_001052491.1.68741 WP_001052491.1.68743 WP_001052491.1.68747 WP_001052491.1.68773 WP_001052491.1.68775 WP_001052491.1.68813 WP_001052491.1.68831 WP_001052491.1.68854 WP_001052491.1.68875 WP_001052491.1.68878 WP_001052491.1.68883 WP_001052491.1.68917 WP_001052491.1.68931 WP_001052491.1.68943 WP_001052491.1.68944 WP_001052491.1.68987 WP_001052491.1.68988 WP_001052491.1.68998 WP_001052491.1.69012 WP_001052491.1.69016 WP_001052491.1.69045 WP_001052491.1.69071 WP_001052491.1.69078 WP_001052491.1.69087 WP_001052491.1.69089 WP_001052491.1.691 WP_001052491.1.69105 WP_001052491.1.69110 WP_001052491.1.69111 WP_001052491.1.69120 WP_001052491.1.69125 WP_001052491.1.69147 WP_001052491.1.6915 WP_001052491.1.69162 WP_001052491.1.6917 WP_001052491.1.69179 WP_001052491.1.69191 WP_001052491.1.69198 WP_001052491.1.69213 WP_001052491.1.69219 WP_001052491.1.69222 WP_001052491.1.69232 WP_001052491.1.69237 WP_001052491.1.69239 WP_001052491.1.69251 WP_001052491.1.69266 WP_001052491.1.69280 WP_001052491.1.69314 WP_001052491.1.69349 WP_001052491.1.69361 WP_001052491.1.69378 WP_001052491.1.69394 WP_001052491.1.69395 WP_001052491.1.69409 WP_001052491.1.69412 WP_001052491.1.69415 WP_001052491.1.6943 WP_001052491.1.69434 WP_001052491.1.69437 WP_001052491.1.69446 WP_001052491.1.69475 WP_001052491.1.69476 WP_001052491.1.69477 WP_001052491.1.69480 WP_001052491.1.69483 WP_001052491.1.69484 WP_001052491.1.69489 WP_001052491.1.69490 WP_001052491.1.69520 WP_001052491.1.6953 WP_001052491.1.69546 WP_001052491.1.69552 WP_001052491.1.69559 WP_001052491.1.69563 WP_001052491.1.69598 WP_001052491.1.69622 WP_001052491.1.69639 WP_001052491.1.69679 WP_001052491.1.6968 WP_001052491.1.69683 WP_001052491.1.69685 WP_001052491.1.69718 WP_001052491.1.69721 WP_001052491.1.69724 WP_001052491.1.69734 WP_001052491.1.69762 WP_001052491.1.6980 WP_001052491.1.69820 WP_001052491.1.69823 WP_001052491.1.69830 WP_001052491.1.69842 WP_001052491.1.69877 WP_001052491.1.69878 WP_001052491.1.69882 WP_001052491.1.699 WP_001052491.1.69902 WP_001052491.1.69921 WP_001052491.1.69934 WP_001052491.1.69980 WP_001052491.1.69987 WP_001052491.1.69995 WP_001052491.1.70024 WP_001052491.1.70048 WP_001052491.1.70059 WP_001052491.1.70089 WP_001052491.1.70094 WP_001052491.1.70105 WP_001052491.1.7012 WP_001052491.1.70133 WP_001052491.1.70161 WP_001052491.1.70210 WP_001052491.1.70220 WP_001052491.1.70225 WP_001052491.1.70228 WP_001052491.1.7024 WP_001052491.1.70253 WP_001052491.1.70266 WP_001052491.1.70273 WP_001052491.1.70294 WP_001052491.1.703 WP_001052491.1.7030 WP_001052491.1.70311 WP_001052491.1.70313 WP_001052491.1.70334 WP_001052491.1.70338 WP_001052491.1.7034 WP_001052491.1.70344 WP_001052491.1.70349 WP_001052491.1.70353 WP_001052491.1.70361 WP_001052491.1.70389 WP_001052491.1.70413 WP_001052491.1.7043 WP_001052491.1.70438 WP_001052491.1.70441 WP_001052491.1.70448 WP_001052491.1.70451 WP_001052491.1.70457 WP_001052491.1.70459 WP_001052491.1.7046 WP_001052491.1.70462 WP_001052491.1.70487 WP_001052491.1.70495 WP_001052491.1.70527 WP_001052491.1.7053 WP_001052491.1.70541 WP_001052491.1.70546 WP_001052491.1.70554 WP_001052491.1.70558 WP_001052491.1.70564 WP_001052491.1.70572 WP_001052491.1.70587 WP_001052491.1.706 WP_001052491.1.7061 WP_001052491.1.70611 WP_001052491.1.70635 WP_001052491.1.7064 WP_001052491.1.70641 WP_001052491.1.7065 WP_001052491.1.70651 WP_001052491.1.70664 WP_001052491.1.7067 WP_001052491.1.70672 WP_001052491.1.707 WP_001052491.1.7071 WP_001052491.1.70721 WP_001052491.1.70763 WP_001052491.1.70790 WP_001052491.1.70791 WP_001052491.1.70807 WP_001052491.1.70808 WP_001052491.1.70818 WP_001052491.1.70823 WP_001052491.1.70829 WP_001052491.1.70835 WP_001052491.1.70843 WP_001052491.1.70850 WP_001052491.1.70855 WP_001052491.1.70909 WP_001052491.1.70917 WP_001052491.1.70924 WP_001052491.1.70926 WP_001052491.1.70930 WP_001052491.1.70939 WP_001052491.1.70943 WP_001052491.1.70994 WP_001052491.1.710 WP_001052491.1.71016 WP_001052491.1.71027 WP_001052491.1.71032 WP_001052491.1.71043 WP_001052491.1.7105 WP_001052491.1.71058 WP_001052491.1.71059 WP_001052491.1.71073 WP_001052491.1.7109 WP_001052491.1.711 WP_001052491.1.71130 WP_001052491.1.71143 WP_001052491.1.71179 WP_001052491.1.71180 WP_001052491.1.71182 WP_001052491.1.7119 WP_001052491.1.71196 WP_001052491.1.7120 WP_001052491.1.71208 WP_001052491.1.71231 WP_001052491.1.71236 WP_001052491.1.7125 WP_001052491.1.71256 WP_001052491.1.71257 WP_001052491.1.71266 WP_001052491.1.71267 WP_001052491.1.71280 WP_001052491.1.71295 WP_001052491.1.71298 WP_001052491.1.71301 WP_001052491.1.71313 WP_001052491.1.71316 WP_001052491.1.71325 WP_001052491.1.71332 WP_001052491.1.71345 WP_001052491.1.71351 WP_001052491.1.71359 WP_001052491.1.71404 WP_001052491.1.71410 WP_001052491.1.71416 WP_001052491.1.71419 WP_001052491.1.71428 WP_001052491.1.71431 WP_001052491.1.71438 WP_001052491.1.71463 WP_001052491.1.71466 WP_001052491.1.71467 WP_001052491.1.71475 WP_001052491.1.71483 WP_001052491.1.7150 WP_001052491.1.71519 WP_001052491.1.71521 WP_001052491.1.71529 WP_001052491.1.71541 WP_001052491.1.71543 WP_001052491.1.71547 WP_001052491.1.71572 WP_001052491.1.71575 WP_001052491.1.7158 WP_001052491.1.71590 WP_001052491.1.71596 WP_001052491.1.71602 WP_001052491.1.7161 WP_001052491.1.7164 WP_001052491.1.71644 WP_001052491.1.71662 WP_001052491.1.71676 WP_001052491.1.71707 WP_001052491.1.71715 WP_001052491.1.71721 WP_001052491.1.71735 WP_001052491.1.71737 WP_001052491.1.71739 WP_001052491.1.71741 WP_001052491.1.71771 WP_001052491.1.71772 WP_001052491.1.71780 WP_001052491.1.71788 WP_001052491.1.7179 WP_001052491.1.71800 WP_001052491.1.71828 WP_001052491.1.71836 WP_001052491.1.71859 WP_001052491.1.71861 WP_001052491.1.71863 WP_001052491.1.71877 WP_001052491.1.71888 WP_001052491.1.71892 WP_001052491.1.71899 WP_001052491.1.71925 WP_001052491.1.7193 WP_001052491.1.71949 WP_001052491.1.71978 WP_001052491.1.7198 WP_001052491.1.71981 WP_001052491.1.71989 WP_001052491.1.72002 WP_001052491.1.72018 WP_001052491.1.72026 WP_001052491.1.72031 WP_001052491.1.72035 WP_001052491.1.72067 WP_001052491.1.72085 WP_001052491.1.72089 WP_001052491.1.72099 WP_001052491.1.72102 WP_001052491.1.72112 WP_001052491.1.72118 WP_001052491.1.72148 WP_001052491.1.72169 WP_001052491.1.72176 WP_001052491.1.722 WP_001052491.1.72204 WP_001052491.1.72205 WP_001052491.1.72224 WP_001052491.1.72257 WP_001052491.1.72271 WP_001052491.1.72285 WP_001052491.1.72306 WP_001052491.1.72315 WP_001052491.1.72330 WP_001052491.1.72340 WP_001052491.1.72347 WP_001052491.1.7236 WP_001052491.1.72363 WP_001052491.1.72366 WP_001052491.1.72371 WP_001052491.1.7242 WP_001052491.1.72424 WP_001052491.1.72433 WP_001052491.1.72446 WP_001052491.1.72453 WP_001052491.1.72465 WP_001052491.1.72478 WP_001052491.1.72489 WP_001052491.1.72496 WP_001052491.1.72497 WP_001052491.1.72529 WP_001052491.1.7254 WP_001052491.1.72547 WP_001052491.1.72564 WP_001052491.1.7258 WP_001052491.1.7260 WP_001052491.1.72626 WP_001052491.1.72649 WP_001052491.1.72654 WP_001052491.1.72666 WP_001052491.1.72708 WP_001052491.1.72719 WP_001052491.1.72750 WP_001052491.1.72753 WP_001052491.1.72760 WP_001052491.1.72762 WP_001052491.1.7278 WP_001052491.1.72787 WP_001052491.1.72816 WP_001052491.1.72832 WP_001052491.1.72834 WP_001052491.1.72835 WP_001052491.1.72874 WP_001052491.1.72881 WP_001052491.1.72903 WP_001052491.1.72904 WP_001052491.1.7292 WP_001052491.1.72930 WP_001052491.1.72935 WP_001052491.1.7294 WP_001052491.1.72945 WP_001052491.1.72961 WP_001052491.1.72965 WP_001052491.1.72991 WP_001052491.1.73002 WP_001052491.1.73004 WP_001052491.1.73017 WP_001052491.1.73019 WP_001052491.1.73021 WP_001052491.1.73022 WP_001052491.1.73034 WP_001052491.1.73037 WP_001052491.1.73046 WP_001052491.1.73074 WP_001052491.1.73087 WP_001052491.1.73121 WP_001052491.1.73122 WP_001052491.1.73132 WP_001052491.1.73140 WP_001052491.1.73190 WP_001052491.1.73191 WP_001052491.1.73195 WP_001052491.1.73201 WP_001052491.1.73211 WP_001052491.1.73240 WP_001052491.1.73241 WP_001052491.1.73246 WP_001052491.1.7326 WP_001052491.1.73264 WP_001052491.1.73265 WP_001052491.1.73286 WP_001052491.1.73312 WP_001052491.1.73386 WP_001052491.1.73401 WP_001052491.1.73402 WP_001052491.1.73420 WP_001052491.1.73444 WP_001052491.1.73450 WP_001052491.1.73456 WP_001052491.1.73464 WP_001052491.1.73467 WP_001052491.1.73489 WP_001052491.1.73501 WP_001052491.1.73513 WP_001052491.1.73526 WP_001052491.1.73536 WP_001052491.1.73539 WP_001052491.1.73547 WP_001052491.1.73571 WP_001052491.1.73591 WP_001052491.1.736 WP_001052491.1.7360 WP_001052491.1.73610 WP_001052491.1.73639 WP_001052491.1.73640 WP_001052491.1.7365 WP_001052491.1.73674 WP_001052491.1.73685 WP_001052491.1.73687 WP_001052491.1.73693 WP_001052491.1.73694 WP_001052491.1.73733 WP_001052491.1.73735 WP_001052491.1.73736 WP_001052491.1.73740 WP_001052491.1.73759 WP_001052491.1.73786 WP_001052491.1.73789 WP_001052491.1.73834 WP_001052491.1.73837 WP_001052491.1.73853 WP_001052491.1.73858 WP_001052491.1.73868 WP_001052491.1.73880 WP_001052491.1.73885 WP_001052491.1.73900 WP_001052491.1.73902 WP_001052491.1.73910 WP_001052491.1.73920 WP_001052491.1.73921 WP_001052491.1.73940 WP_001052491.1.73949 WP_001052491.1.73961 WP_001052491.1.73969 WP_001052491.1.73971 WP_001052491.1.73976 WP_001052491.1.73983 WP_001052491.1.74004 WP_001052491.1.74006 WP_001052491.1.74008 WP_001052491.1.7401 WP_001052491.1.74010 WP_001052491.1.74013 WP_001052491.1.74025 WP_001052491.1.74027 WP_001052491.1.7406 WP_001052491.1.74073 WP_001052491.1.74081 WP_001052491.1.74085 WP_001052491.1.74138 WP_001052491.1.74155 WP_001052491.1.74157 WP_001052491.1.74158 WP_001052491.1.74161 WP_001052491.1.74172 WP_001052491.1.74173 WP_001052491.1.7418 WP_001052491.1.74183 WP_001052491.1.74187 WP_001052491.1.74201 WP_001052491.1.74216 WP_001052491.1.74221 WP_001052491.1.74234 WP_001052491.1.74237 WP_001052491.1.74242 WP_001052491.1.74257 WP_001052491.1.7427 WP_001052491.1.74273 WP_001052491.1.7428 WP_001052491.1.74284 WP_001052491.1.74295 WP_001052491.1.74327 WP_001052491.1.74338 WP_001052491.1.7434 WP_001052491.1.74353 WP_001052491.1.74356 WP_001052491.1.74380 WP_001052491.1.74390 WP_001052491.1.74429 WP_001052491.1.74456 WP_001052491.1.74457 WP_001052491.1.74468 WP_001052491.1.74474 WP_001052491.1.74486 WP_001052491.1.74497 WP_001052491.1.74510 WP_001052491.1.74533 WP_001052491.1.74556 WP_001052491.1.7457 WP_001052491.1.74576 WP_001052491.1.74587 WP_001052491.1.74590 WP_001052491.1.74610 WP_001052491.1.74638 WP_001052491.1.74645 WP_001052491.1.74676 WP_001052491.1.74681 WP_001052491.1.74693 WP_001052491.1.74696 WP_001052491.1.74704 WP_001052491.1.74731 WP_001052491.1.74747 WP_001052491.1.74758 WP_001052491.1.74761 WP_001052491.1.74770 WP_001052491.1.74775 WP_001052491.1.74781 WP_001052491.1.74785 WP_001052491.1.74797 WP_001052491.1.74802 WP_001052491.1.74808 WP_001052491.1.7482 WP_001052491.1.74840 WP_001052491.1.74846 WP_001052491.1.74849 WP_001052491.1.74866 WP_001052491.1.74874 WP_001052491.1.74890 WP_001052491.1.74899 WP_001052491.1.74911 WP_001052491.1.74922 WP_001052491.1.74924 WP_001052491.1.74961 WP_001052491.1.74963 WP_001052491.1.74978 WP_001052491.1.74985 WP_001052491.1.74994 WP_001052491.1.74999 WP_001052491.1.7500 WP_001052491.1.75006 WP_001052491.1.75038 WP_001052491.1.75044 WP_001052491.1.75048 WP_001052491.1.75052 WP_001052491.1.75070 WP_001052491.1.75091 WP_001052491.1.75093 WP_001052491.1.75111 WP_001052491.1.75122 WP_001052491.1.75127 WP_001052491.1.75131 WP_001052491.1.75132 WP_001052491.1.75141 WP_001052491.1.75186 WP_001052491.1.75227 WP_001052491.1.75252 WP_001052491.1.75253 WP_001052491.1.75294 WP_001052491.1.75298 WP_001052491.1.75304 WP_001052491.1.75320 WP_001052491.1.75323 WP_001052491.1.75327 WP_001052491.1.75349 WP_001052491.1.75351 WP_001052491.1.75356 WP_001052491.1.75365 WP_001052491.1.75369 WP_001052491.1.75375 WP_001052491.1.75379 WP_001052491.1.75399 WP_001052491.1.75409 WP_001052491.1.75411 WP_001052491.1.7542 WP_001052491.1.75438 WP_001052491.1.75440 WP_001052491.1.75481 WP_001052491.1.75506 WP_001052491.1.75509 WP_001052491.1.75521 WP_001052491.1.75527 WP_001052491.1.75538 WP_001052491.1.75542 WP_001052491.1.75551 WP_001052491.1.75566 WP_001052491.1.75571 WP_001052491.1.75590 WP_001052491.1.7561 WP_001052491.1.75623 WP_001052491.1.75647 WP_001052491.1.75649 WP_001052491.1.75652 WP_001052491.1.75680 WP_001052491.1.75685 WP_001052491.1.75692 WP_001052491.1.75704 WP_001052491.1.75728 WP_001052491.1.75743 WP_001052491.1.75769 WP_001052491.1.75770 WP_001052491.1.75775 WP_001052491.1.758 WP_001052491.1.75800 WP_001052491.1.75805 WP_001052491.1.75809 WP_001052491.1.75824 WP_001052491.1.75830 WP_001052491.1.7584 WP_001052491.1.75848 WP_001052491.1.75851 WP_001052491.1.75856 WP_001052491.1.75862 WP_001052491.1.75879 WP_001052491.1.75881 WP_001052491.1.75885 WP_001052491.1.75910 WP_001052491.1.75929 WP_001052491.1.75944 WP_001052491.1.75952 WP_001052491.1.75956 WP_001052491.1.7596 WP_001052491.1.75969 WP_001052491.1.76010 WP_001052491.1.76013 WP_001052491.1.76015 WP_001052491.1.7602 WP_001052491.1.76047 WP_001052491.1.76049 WP_001052491.1.76050 WP_001052491.1.76053 WP_001052491.1.7607 WP_001052491.1.76071 WP_001052491.1.76073 WP_001052491.1.76095 WP_001052491.1.76104 WP_001052491.1.76111 WP_001052491.1.76112 WP_001052491.1.76114 WP_001052491.1.76121 WP_001052491.1.76123 WP_001052491.1.76136 WP_001052491.1.76143 WP_001052491.1.76149 WP_001052491.1.76153 WP_001052491.1.76179 WP_001052491.1.76185 WP_001052491.1.76221 WP_001052491.1.76230 WP_001052491.1.76234 WP_001052491.1.7624 WP_001052491.1.7625 WP_001052491.1.76258 WP_001052491.1.76261 WP_001052491.1.7627 WP_001052491.1.76282 WP_001052491.1.76283 WP_001052491.1.76294 WP_001052491.1.76295 WP_001052491.1.76313 WP_001052491.1.76323 WP_001052491.1.76332 WP_001052491.1.76333 WP_001052491.1.76337 WP_001052491.1.76351 WP_001052491.1.7638 WP_001052491.1.76411 WP_001052491.1.76419 WP_001052491.1.76420 WP_001052491.1.76421 WP_001052491.1.76424 WP_001052491.1.76426 WP_001052491.1.76431 WP_001052491.1.76463 WP_001052491.1.76482 WP_001052491.1.76497 WP_001052491.1.765 WP_001052491.1.76528 WP_001052491.1.7658 WP_001052491.1.76604 WP_001052491.1.76606 WP_001052491.1.76624 WP_001052491.1.76648 WP_001052491.1.76659 WP_001052491.1.76674 WP_001052491.1.76686 WP_001052491.1.76689 WP_001052491.1.76690 WP_001052491.1.76693 WP_001052491.1.76711 WP_001052491.1.76718 WP_001052491.1.7675 WP_001052491.1.76790 WP_001052491.1.76792 WP_001052491.1.76798 WP_001052491.1.768 WP_001052491.1.76803 WP_001052491.1.76816 WP_001052491.1.76820 WP_001052491.1.76825 WP_001052491.1.76829 WP_001052491.1.76839 WP_001052491.1.76845 WP_001052491.1.7686 WP_001052491.1.76867 WP_001052491.1.76869 WP_001052491.1.76872 WP_001052491.1.76876 WP_001052491.1.76878 WP_001052491.1.76895 WP_001052491.1.76897 WP_001052491.1.76920 WP_001052491.1.76921 WP_001052491.1.76937 WP_001052491.1.7694 WP_001052491.1.76944 WP_001052491.1.76952 WP_001052491.1.76998 WP_001052491.1.77013 WP_001052491.1.77020 WP_001052491.1.77027 WP_001052491.1.77031 WP_001052491.1.77041 WP_001052491.1.77043 WP_001052491.1.77050 WP_001052491.1.77060 WP_001052491.1.77062 WP_001052491.1.77069 WP_001052491.1.77072 WP_001052491.1.77112 WP_001052491.1.77137 WP_001052491.1.77144 WP_001052491.1.77145 WP_001052491.1.77158 WP_001052491.1.77176 WP_001052491.1.77183 WP_001052491.1.77187 WP_001052491.1.77190 WP_001052491.1.77203 WP_001052491.1.77229 WP_001052491.1.77256 WP_001052491.1.77259 WP_001052491.1.77297 WP_001052491.1.77298 WP_001052491.1.77305 WP_001052491.1.77315 WP_001052491.1.77331 WP_001052491.1.77346 WP_001052491.1.77354 WP_001052491.1.77359 WP_001052491.1.77383 WP_001052491.1.77388 WP_001052491.1.77416 WP_001052491.1.77426 WP_001052491.1.77446 WP_001052491.1.7745 WP_001052491.1.7746 WP_001052491.1.77460 WP_001052491.1.77485 WP_001052491.1.77489 WP_001052491.1.77497 WP_001052491.1.77498 WP_001052491.1.7752 WP_001052491.1.77520 WP_001052491.1.77527 WP_001052491.1.77532 WP_001052491.1.77533 WP_001052491.1.77536 WP_001052491.1.77572 WP_001052491.1.77583 WP_001052491.1.77603 WP_001052491.1.77606 WP_001052491.1.77650 WP_001052491.1.77665 WP_001052491.1.77674 WP_001052491.1.77730 WP_001052491.1.77733 WP_001052491.1.77735 WP_001052491.1.77738 WP_001052491.1.7774 WP_001052491.1.77743 WP_001052491.1.77745 WP_001052491.1.77763 WP_001052491.1.77791 WP_001052491.1.77805 WP_001052491.1.77814 WP_001052491.1.77818 WP_001052491.1.77822 WP_001052491.1.77827 WP_001052491.1.77832 WP_001052491.1.77848 WP_001052491.1.7785 WP_001052491.1.77858 WP_001052491.1.7786 WP_001052491.1.77860 WP_001052491.1.7787 WP_001052491.1.77882 WP_001052491.1.77883 WP_001052491.1.77893 WP_001052491.1.77896 WP_001052491.1.77908 WP_001052491.1.77915 WP_001052491.1.77922 WP_001052491.1.77930 WP_001052491.1.77952 WP_001052491.1.77957 WP_001052491.1.77986 WP_001052491.1.78002 WP_001052491.1.78038 WP_001052491.1.78050 WP_001052491.1.78054 WP_001052491.1.78067 WP_001052491.1.78082 WP_001052491.1.78091 WP_001052491.1.78093 WP_001052491.1.78095 WP_001052491.1.7810 WP_001052491.1.78116 WP_001052491.1.78126 WP_001052491.1.78164 WP_001052491.1.78173 WP_001052491.1.78179 WP_001052491.1.78185 WP_001052491.1.78189 WP_001052491.1.78194 WP_001052491.1.78207 WP_001052491.1.78208 WP_001052491.1.78210 WP_001052491.1.78252 WP_001052491.1.78254 WP_001052491.1.78257 WP_001052491.1.7827 WP_001052491.1.78304 WP_001052491.1.78311 WP_001052491.1.78324 WP_001052491.1.7833 WP_001052491.1.78330 WP_001052491.1.78332 WP_001052491.1.78335 WP_001052491.1.78365 WP_001052491.1.78371 WP_001052491.1.78392 WP_001052491.1.78404 WP_001052491.1.78434 WP_001052491.1.78436 WP_001052491.1.78458 WP_001052491.1.78470 WP_001052491.1.78478 WP_001052491.1.78489 WP_001052491.1.78494 WP_001052491.1.7850 WP_001052491.1.78513 WP_001052491.1.7853 WP_001052491.1.78550 WP_001052491.1.78558 WP_001052491.1.7857 WP_001052491.1.78573 WP_001052491.1.78582 WP_001052491.1.78585 WP_001052491.1.78592 WP_001052491.1.78596 WP_001052491.1.78598 WP_001052491.1.78604 WP_001052491.1.78625 WP_001052491.1.78633 WP_001052491.1.78638 WP_001052491.1.78653 WP_001052491.1.78662 WP_001052491.1.78667 WP_001052491.1.7868 WP_001052491.1.78685 WP_001052491.1.78708 WP_001052491.1.78728 WP_001052491.1.78731 WP_001052491.1.78736 WP_001052491.1.78758 WP_001052491.1.78763 WP_001052491.1.78785 WP_001052491.1.78803 WP_001052491.1.78816 WP_001052491.1.78819 WP_001052491.1.78841 WP_001052491.1.78872 WP_001052491.1.7888 WP_001052491.1.78897 WP_001052491.1.78920 WP_001052491.1.78934 WP_001052491.1.78937 WP_001052491.1.78946 WP_001052491.1.78978 WP_001052491.1.78983 WP_001052491.1.78985 WP_001052491.1.78991 WP_001052491.1.78995 WP_001052491.1.7900 WP_001052491.1.79006 WP_001052491.1.79037 WP_001052491.1.79038 WP_001052491.1.7905 WP_001052491.1.79051 WP_001052491.1.79055 WP_001052491.1.79059 WP_001052491.1.79085 WP_001052491.1.79110 WP_001052491.1.79114 WP_001052491.1.79131 WP_001052491.1.79132 WP_001052491.1.7914 WP_001052491.1.79143 WP_001052491.1.79156 WP_001052491.1.79170 WP_001052491.1.79178 WP_001052491.1.79192 WP_001052491.1.79197 WP_001052491.1.79208 WP_001052491.1.79223 WP_001052491.1.79227 WP_001052491.1.79244 WP_001052491.1.79270 WP_001052491.1.79275 WP_001052491.1.79285 WP_001052491.1.7930 WP_001052491.1.7931 WP_001052491.1.79310 WP_001052491.1.79314 WP_001052491.1.79320 WP_001052491.1.79322 WP_001052491.1.79332 WP_001052491.1.79334 WP_001052491.1.7934 WP_001052491.1.79341 WP_001052491.1.79367 WP_001052491.1.79374 WP_001052491.1.79378 WP_001052491.1.79379 WP_001052491.1.79400 WP_001052491.1.79402 WP_001052491.1.79407 WP_001052491.1.79408 WP_001052491.1.79436 WP_001052491.1.79452 WP_001052491.1.79461 WP_001052491.1.79473 WP_001052491.1.79476 WP_001052491.1.79487 WP_001052491.1.79539 WP_001052491.1.79543 WP_001052491.1.79552 WP_001052491.1.79554 WP_001052491.1.79556 WP_001052491.1.79566 WP_001052491.1.79581 WP_001052491.1.79626 WP_001052491.1.79627 WP_001052491.1.79638 WP_001052491.1.79646 WP_001052491.1.79662 WP_001052491.1.79664 WP_001052491.1.79672 WP_001052491.1.79676 WP_001052491.1.79677 WP_001052491.1.79706 WP_001052491.1.79731 WP_001052491.1.79737 WP_001052491.1.79763 WP_001052491.1.7981 WP_001052491.1.79810 WP_001052491.1.79815 WP_001052491.1.79822 WP_001052491.1.79831 WP_001052491.1.79834 WP_001052491.1.79837 WP_001052491.1.79854 WP_001052491.1.79855 WP_001052491.1.7989 WP_001052491.1.79896 WP_001052491.1.79911 WP_001052491.1.79919 WP_001052491.1.7992 WP_001052491.1.79941 WP_001052491.1.79949 WP_001052491.1.79961 WP_001052491.1.79971 WP_001052491.1.79991 WP_001052491.1.80000 WP_001052491.1.80009 WP_001052491.1.80013 WP_001052491.1.80029 WP_001052491.1.80032 WP_001052491.1.80034 WP_001052491.1.80042 WP_001052491.1.80079 WP_001052491.1.80086 WP_001052491.1.80109 WP_001052491.1.80119 WP_001052491.1.80120 WP_001052491.1.80122 WP_001052491.1.80124 WP_001052491.1.80127 WP_001052491.1.80146 WP_001052491.1.80147 WP_001052491.1.80152 WP_001052491.1.80159 WP_001052491.1.80178 WP_001052491.1.80181 WP_001052491.1.80184 WP_001052491.1.80193 WP_001052491.1.80203 WP_001052491.1.80210 WP_001052491.1.80244 WP_001052491.1.80274 WP_001052491.1.80286 WP_001052491.1.80287 WP_001052491.1.80290 WP_001052491.1.80297 WP_001052491.1.8030 WP_001052491.1.80303 WP_001052491.1.80308 WP_001052491.1.8031 WP_001052491.1.80316 WP_001052491.1.80317 WP_001052491.1.80318 WP_001052491.1.80336 WP_001052491.1.80345 WP_001052491.1.8035 WP_001052491.1.80358 WP_001052491.1.80361 WP_001052491.1.80378 WP_001052491.1.80389 WP_001052491.1.80393 WP_001052491.1.8040 WP_001052491.1.80407 WP_001052491.1.80414 WP_001052491.1.8043 WP_001052491.1.80430 WP_001052491.1.80434 WP_001052491.1.8045 WP_001052491.1.8047 WP_001052491.1.80472 WP_001052491.1.80482 WP_001052491.1.80521 WP_001052491.1.80530 WP_001052491.1.80582 WP_001052491.1.8062 WP_001052491.1.80647 WP_001052491.1.8065 WP_001052491.1.80653 WP_001052491.1.8066 WP_001052491.1.80680 WP_001052491.1.80687 WP_001052491.1.80717 WP_001052491.1.80721 WP_001052491.1.80734 WP_001052491.1.80745 WP_001052491.1.80761 WP_001052491.1.80762 WP_001052491.1.80763 WP_001052491.1.8077 WP_001052491.1.80781 WP_001052491.1.80786 WP_001052491.1.80793 WP_001052491.1.80801 WP_001052491.1.80828 WP_001052491.1.80833 WP_001052491.1.8084 WP_001052491.1.80845 WP_001052491.1.8085 WP_001052491.1.80855 WP_001052491.1.80872 WP_001052491.1.80899 WP_001052491.1.809 WP_001052491.1.80962 WP_001052491.1.80972 WP_001052491.1.80979 WP_001052491.1.80980 WP_001052491.1.81010 WP_001052491.1.81022 WP_001052491.1.81049 WP_001052491.1.81052 WP_001052491.1.81055 WP_001052491.1.81064 WP_001052491.1.81065 WP_001052491.1.81085 WP_001052491.1.81092 WP_001052491.1.81095 WP_001052491.1.81097 WP_001052491.1.81114 WP_001052491.1.81132 WP_001052491.1.81151 WP_001052491.1.81154 WP_001052491.1.81157 WP_001052491.1.81162 WP_001052491.1.81171 WP_001052491.1.81172 WP_001052491.1.81176 WP_001052491.1.81184 WP_001052491.1.81214 WP_001052491.1.81224 WP_001052491.1.81228 WP_001052491.1.81234 WP_001052491.1.81243 WP_001052491.1.8125 WP_001052491.1.81252 WP_001052491.1.81288 WP_001052491.1.81290 WP_001052491.1.81344 WP_001052491.1.8135 WP_001052491.1.81379 WP_001052491.1.81384 WP_001052491.1.81385 WP_001052491.1.81387 WP_001052491.1.81389 WP_001052491.1.8142 WP_001052491.1.81436 WP_001052491.1.8144 WP_001052491.1.81464 WP_001052491.1.81467 WP_001052491.1.81508 WP_001052491.1.81522 WP_001052491.1.81532 WP_001052491.1.81549 WP_001052491.1.81572 WP_001052491.1.81574 WP_001052491.1.81599 WP_001052491.1.8160 WP_001052491.1.81604 WP_001052491.1.81610 WP_001052491.1.81619 WP_001052491.1.81631 WP_001052491.1.81637 WP_001052491.1.81645 WP_001052491.1.81651 WP_001052491.1.81718 WP_001052491.1.81734 WP_001052491.1.81738 WP_001052491.1.81740 WP_001052491.1.81758 WP_001052491.1.8176 WP_001052491.1.81767 WP_001052491.1.81789 WP_001052491.1.8180 WP_001052491.1.81800 WP_001052491.1.81810 WP_001052491.1.81811 WP_001052491.1.81812 WP_001052491.1.81829 WP_001052491.1.81831 WP_001052491.1.81837 WP_001052491.1.81838 WP_001052491.1.81847 WP_001052491.1.8185 WP_001052491.1.81861 WP_001052491.1.81870 WP_001052491.1.8188 WP_001052491.1.81897 WP_001052491.1.81903 WP_001052491.1.81904 WP_001052491.1.81905 WP_001052491.1.81906 WP_001052491.1.81919 WP_001052491.1.81940 WP_001052491.1.81944 WP_001052491.1.81955 WP_001052491.1.81969 WP_001052491.1.81982 WP_001052491.1.81990 WP_001052491.1.81996 WP_001052491.1.81999 WP_001052491.1.82009 WP_001052491.1.82015 WP_001052491.1.82017 WP_001052491.1.82026 WP_001052491.1.82053 WP_001052491.1.82058 WP_001052491.1.8206 WP_001052491.1.82091 WP_001052491.1.82100 WP_001052491.1.82103 WP_001052491.1.8212 WP_001052491.1.82121 WP_001052491.1.8213 WP_001052491.1.82161 WP_001052491.1.82167 WP_001052491.1.82174 WP_001052491.1.82184 WP_001052491.1.82219 WP_001052491.1.82234 WP_001052491.1.82247 WP_001052491.1.82253 WP_001052491.1.82259 WP_001052491.1.82278 WP_001052491.1.82281 WP_001052491.1.82301 WP_001052491.1.82315 WP_001052491.1.82321 WP_001052491.1.82340 WP_001052491.1.82349 WP_001052491.1.82354 WP_001052491.1.82358 WP_001052491.1.82368 WP_001052491.1.82406 WP_001052491.1.8244 WP_001052491.1.82441 WP_001052491.1.82447 WP_001052491.1.82455 WP_001052491.1.82458 WP_001052491.1.8246 WP_001052491.1.82467 WP_001052491.1.82468 WP_001052491.1.82472 WP_001052491.1.82525 WP_001052491.1.82535 WP_001052491.1.82548 WP_001052491.1.82558 WP_001052491.1.8260 WP_001052491.1.8261 WP_001052491.1.82612 WP_001052491.1.8265 WP_001052491.1.8266 WP_001052491.1.82664 WP_001052491.1.82665 WP_001052491.1.82678 WP_001052491.1.82709 WP_001052491.1.82724 WP_001052491.1.82760 WP_001052491.1.82762 WP_001052491.1.82768 WP_001052491.1.82775 WP_001052491.1.82796 WP_001052491.1.8280 WP_001052491.1.82802 WP_001052491.1.82824 WP_001052491.1.82829 WP_001052491.1.82835 WP_001052491.1.82855 WP_001052491.1.82862 WP_001052491.1.8288 WP_001052491.1.8289 WP_001052491.1.82916 WP_001052491.1.82930 WP_001052491.1.82931 WP_001052491.1.82941 WP_001052491.1.82976 WP_001052491.1.82980 WP_001052491.1.82984 WP_001052491.1.82997 WP_001052491.1.82999 WP_001052491.1.83011 WP_001052491.1.83013 WP_001052491.1.8302 WP_001052491.1.83021 WP_001052491.1.83046 WP_001052491.1.83050 WP_001052491.1.83053 WP_001052491.1.83054 WP_001052491.1.83066 WP_001052491.1.83078 WP_001052491.1.83086 WP_001052491.1.83088 WP_001052491.1.8310 WP_001052491.1.83103 WP_001052491.1.83152 WP_001052491.1.83153 WP_001052491.1.8318 WP_001052491.1.83185 WP_001052491.1.8319 WP_001052491.1.83193 WP_001052491.1.83203 WP_001052491.1.83234 WP_001052491.1.83243 WP_001052491.1.83249 WP_001052491.1.83250 WP_001052491.1.8328 WP_001052491.1.83291 WP_001052491.1.83314 WP_001052491.1.83316 WP_001052491.1.83352 WP_001052491.1.83359 WP_001052491.1.83372 WP_001052491.1.83405 WP_001052491.1.83416 WP_001052491.1.83417 WP_001052491.1.83418 WP_001052491.1.8346 WP_001052491.1.83467 WP_001052491.1.83468 WP_001052491.1.83472 WP_001052491.1.83475 WP_001052491.1.83476 WP_001052491.1.83479 WP_001052491.1.83484 WP_001052491.1.83508 WP_001052491.1.83517 WP_001052491.1.83520 WP_001052491.1.83541 WP_001052491.1.83553 WP_001052491.1.83592 WP_001052491.1.83593 WP_001052491.1.83597 WP_001052491.1.83599 WP_001052491.1.83624 WP_001052491.1.83626 WP_001052491.1.83645 WP_001052491.1.83646 WP_001052491.1.83652 WP_001052491.1.83653 WP_001052491.1.8366 WP_001052491.1.83674 WP_001052491.1.83676 WP_001052491.1.83714 WP_001052491.1.83720 WP_001052491.1.83728 WP_001052491.1.83750 WP_001052491.1.83756 WP_001052491.1.83758 WP_001052491.1.83763 WP_001052491.1.83769 WP_001052491.1.83770 WP_001052491.1.83775 WP_001052491.1.83778 WP_001052491.1.83788 WP_001052491.1.83792 WP_001052491.1.83797 WP_001052491.1.83804 WP_001052491.1.83816 WP_001052491.1.83825 WP_001052491.1.8383 WP_001052491.1.83837 WP_001052491.1.83844 WP_001052491.1.8385 WP_001052491.1.83852 WP_001052491.1.83864 WP_001052491.1.83865 WP_001052491.1.83868 WP_001052491.1.83881 WP_001052491.1.83886 WP_001052491.1.83902 WP_001052491.1.83905 WP_001052491.1.83912 WP_001052491.1.83917 WP_001052491.1.83919 WP_001052491.1.83925 WP_001052491.1.83928 WP_001052491.1.83935 WP_001052491.1.83955 WP_001052491.1.83980 WP_001052491.1.83984 WP_001052491.1.83989 WP_001052491.1.84010 WP_001052491.1.84025 WP_001052491.1.84041 WP_001052491.1.84049 WP_001052491.1.84054 WP_001052491.1.84064 WP_001052491.1.84067 WP_001052491.1.84068 WP_001052491.1.84118 WP_001052491.1.84129 WP_001052491.1.84144 WP_001052491.1.84161 WP_001052491.1.84163 WP_001052491.1.84188 WP_001052491.1.84194 WP_001052491.1.84275 WP_001052491.1.84284 WP_001052491.1.84293 WP_001052491.1.8432 WP_001052491.1.84322 WP_001052491.1.84342 WP_001052491.1.84414 WP_001052491.1.84415 WP_001052491.1.84416 WP_001052491.1.84418 WP_001052491.1.84442 WP_001052491.1.84445 WP_001052491.1.84451 WP_001052491.1.84508 WP_001052491.1.84509 WP_001052491.1.84555 WP_001052491.1.84563 WP_001052491.1.84570 WP_001052491.1.84590 WP_001052491.1.84596 WP_001052491.1.84602 WP_001052491.1.84608 WP_001052491.1.84612 WP_001052491.1.8462 WP_001052491.1.84625 WP_001052491.1.84630 WP_001052491.1.84638 WP_001052491.1.84648 WP_001052491.1.84651 WP_001052491.1.84652 WP_001052491.1.84662 WP_001052491.1.84673 WP_001052491.1.84679 WP_001052491.1.8468 WP_001052491.1.84682 WP_001052491.1.84696 WP_001052491.1.84700 WP_001052491.1.84714 WP_001052491.1.84736 WP_001052491.1.8475 WP_001052491.1.84752 WP_001052491.1.84757 WP_001052491.1.84761 WP_001052491.1.84767 WP_001052491.1.84770 WP_001052491.1.84776 WP_001052491.1.84815 WP_001052491.1.8482 WP_001052491.1.84826 WP_001052491.1.84844 WP_001052491.1.84847 WP_001052491.1.84854 WP_001052491.1.84874 WP_001052491.1.84889 WP_001052491.1.84903 WP_001052491.1.84907 WP_001052491.1.84922 WP_001052491.1.84924 WP_001052491.1.8493 WP_001052491.1.84943 WP_001052491.1.84951 WP_001052491.1.8496 WP_001052491.1.84975 WP_001052491.1.84978 WP_001052491.1.85017 WP_001052491.1.85022 WP_001052491.1.85026 WP_001052491.1.85045 WP_001052491.1.85047 WP_001052491.1.85056 WP_001052491.1.85070 WP_001052491.1.85081 WP_001052491.1.85083 WP_001052491.1.85099 WP_001052491.1.851 WP_001052491.1.85113 WP_001052491.1.85118 WP_001052491.1.85132 WP_001052491.1.85133 WP_001052491.1.85135 WP_001052491.1.85144 WP_001052491.1.85151 WP_001052491.1.85160 WP_001052491.1.85173 WP_001052491.1.85198 WP_001052491.1.85213 WP_001052491.1.85224 WP_001052491.1.85226 WP_001052491.1.85229 WP_001052491.1.85231 WP_001052491.1.85235 WP_001052491.1.85238 WP_001052491.1.85265 WP_001052491.1.85289 WP_001052491.1.85292 WP_001052491.1.85294 WP_001052491.1.85297 WP_001052491.1.85302 WP_001052491.1.85331 WP_001052491.1.85351 WP_001052491.1.85354 WP_001052491.1.85374 WP_001052491.1.85375 WP_001052491.1.85376 WP_001052491.1.85383 WP_001052491.1.85391 WP_001052491.1.85395 WP_001052491.1.85401 WP_001052491.1.85404 WP_001052491.1.85409 WP_001052491.1.85425 WP_001052491.1.85440 WP_001052491.1.85441 WP_001052491.1.85445 WP_001052491.1.85455 WP_001052491.1.85462 WP_001052491.1.85471 WP_001052491.1.85474 WP_001052491.1.85485 WP_001052491.1.85492 WP_001052491.1.85506 WP_001052491.1.8551 WP_001052491.1.85515 WP_001052491.1.85519 WP_001052491.1.85542 WP_001052491.1.85547 WP_001052491.1.85549 WP_001052491.1.85555 WP_001052491.1.85562 WP_001052491.1.85585 WP_001052491.1.85586 WP_001052491.1.85596 WP_001052491.1.85607 WP_001052491.1.85611 WP_001052491.1.85634 WP_001052491.1.85649 WP_001052491.1.85678 WP_001052491.1.85705 WP_001052491.1.8572 WP_001052491.1.85730 WP_001052491.1.85732 WP_001052491.1.85758 WP_001052491.1.8576 WP_001052491.1.85795 WP_001052491.1.85796 WP_001052491.1.85809 WP_001052491.1.85816 WP_001052491.1.85825 WP_001052491.1.85834 WP_001052491.1.85844 WP_001052491.1.85858 WP_001052491.1.85873 WP_001052491.1.85906 WP_001052491.1.85924 WP_001052491.1.85927 WP_001052491.1.85950 WP_001052491.1.85971 WP_001052491.1.85980 WP_001052491.1.85989 WP_001052491.1.85993 WP_001052491.1.86018 WP_001052491.1.86036 WP_001052491.1.86042 WP_001052491.1.86072 WP_001052491.1.86086 WP_001052491.1.8609 WP_001052491.1.86101 WP_001052491.1.86106 WP_001052491.1.86123 WP_001052491.1.86136 WP_001052491.1.86144 WP_001052491.1.86153 WP_001052491.1.86154 WP_001052491.1.86158 WP_001052491.1.8617 WP_001052491.1.86178 WP_001052491.1.86188 WP_001052491.1.86197 WP_001052491.1.862 WP_001052491.1.86202 WP_001052491.1.86207 WP_001052491.1.86209 WP_001052491.1.86241 WP_001052491.1.86248 WP_001052491.1.86256 WP_001052491.1.8627 WP_001052491.1.86270 WP_001052491.1.86281 WP_001052491.1.86298 WP_001052491.1.86304 WP_001052491.1.86315 WP_001052491.1.86331 WP_001052491.1.86344 WP_001052491.1.8636 WP_001052491.1.86363 WP_001052491.1.86367 WP_001052491.1.86378 WP_001052491.1.86390 WP_001052491.1.8641 WP_001052491.1.8643 WP_001052491.1.86439 WP_001052491.1.86455 WP_001052491.1.86473 WP_001052491.1.86482 WP_001052491.1.86505 WP_001052491.1.86508 WP_001052491.1.86523 WP_001052491.1.86526 WP_001052491.1.86531 WP_001052491.1.86542 WP_001052491.1.86606 WP_001052491.1.86628 WP_001052491.1.86629 WP_001052491.1.8663 WP_001052491.1.86664 WP_001052491.1.86704 WP_001052491.1.86706 WP_001052491.1.86736 WP_001052491.1.86745 WP_001052491.1.86754 WP_001052491.1.86779 WP_001052491.1.86792 WP_001052491.1.86793 WP_001052491.1.86795 WP_001052491.1.8681 WP_001052491.1.86838 WP_001052491.1.86881 WP_001052491.1.8690 WP_001052491.1.86910 WP_001052491.1.86911 WP_001052491.1.86916 WP_001052491.1.86942 WP_001052491.1.86955 WP_001052491.1.86961 WP_001052491.1.86968 WP_001052491.1.86977 WP_001052491.1.8699 WP_001052491.1.86999 WP_001052491.1.87021 WP_001052491.1.87022 WP_001052491.1.87042 WP_001052491.1.87057 WP_001052491.1.87072 WP_001052491.1.87088 WP_001052491.1.87090 WP_001052491.1.87096 WP_001052491.1.87097 WP_001052491.1.87100 WP_001052491.1.87110 WP_001052491.1.87119 WP_001052491.1.8712 WP_001052491.1.87122 WP_001052491.1.87133 WP_001052491.1.87137 WP_001052491.1.87141 WP_001052491.1.87168 WP_001052491.1.87175 WP_001052491.1.87190 WP_001052491.1.87194 WP_001052491.1.8720 WP_001052491.1.87221 WP_001052491.1.87236 WP_001052491.1.87250 WP_001052491.1.87260 WP_001052491.1.87261 WP_001052491.1.87263 WP_001052491.1.87264 WP_001052491.1.87272 WP_001052491.1.87285 WP_001052491.1.87290 WP_001052491.1.87296 WP_001052491.1.87308 WP_001052491.1.8731 WP_001052491.1.87363 WP_001052491.1.87372 WP_001052491.1.87378 WP_001052491.1.87388 WP_001052491.1.87391 WP_001052491.1.87396 WP_001052491.1.87397 WP_001052491.1.87425 WP_001052491.1.87434 WP_001052491.1.87457 WP_001052491.1.87461 WP_001052491.1.87466 WP_001052491.1.87475 WP_001052491.1.87486 WP_001052491.1.87497 WP_001052491.1.87498 WP_001052491.1.875 WP_001052491.1.87502 WP_001052491.1.87508 WP_001052491.1.87511 WP_001052491.1.87515 WP_001052491.1.87520 WP_001052491.1.8753 WP_001052491.1.87534 WP_001052491.1.87541 WP_001052491.1.87543 WP_001052491.1.8757 WP_001052491.1.87579 WP_001052491.1.87593 WP_001052491.1.87595 WP_001052491.1.87601 WP_001052491.1.87623 WP_001052491.1.87636 WP_001052491.1.8764 WP_001052491.1.87647 WP_001052491.1.87682 WP_001052491.1.8770 WP_001052491.1.87703 WP_001052491.1.87710 WP_001052491.1.87718 WP_001052491.1.87734 WP_001052491.1.87735 WP_001052491.1.87740 WP_001052491.1.87745 WP_001052491.1.87748 WP_001052491.1.87764 WP_001052491.1.87782 WP_001052491.1.8779 WP_001052491.1.87802 WP_001052491.1.87808 WP_001052491.1.87828 WP_001052491.1.87838 WP_001052491.1.87841 WP_001052491.1.87843 WP_001052491.1.87854 WP_001052491.1.87865 WP_001052491.1.87879 WP_001052491.1.8791 WP_001052491.1.87912 WP_001052491.1.87937 WP_001052491.1.87943 WP_001052491.1.87948 WP_001052491.1.87963 WP_001052491.1.87964 WP_001052491.1.87967 WP_001052491.1.87972 WP_001052491.1.87985 WP_001052491.1.87995 WP_001052491.1.88013 WP_001052491.1.88024 WP_001052491.1.88032 WP_001052491.1.88061 WP_001052491.1.88101 WP_001052491.1.88114 WP_001052491.1.88150 WP_001052491.1.88166 WP_001052491.1.88169 WP_001052491.1.8820 WP_001052491.1.88212 WP_001052491.1.88240 WP_001052491.1.88270 WP_001052491.1.88279 WP_001052491.1.88309 WP_001052491.1.88311 WP_001052491.1.88317 WP_001052491.1.88319 WP_001052491.1.88328 WP_001052491.1.88339 WP_001052491.1.88348 WP_001052491.1.88351 WP_001052491.1.88363 WP_001052491.1.88367 WP_001052491.1.88371 WP_001052491.1.88373 WP_001052491.1.88375 WP_001052491.1.88380 WP_001052491.1.88392 WP_001052491.1.88395 WP_001052491.1.88418 WP_001052491.1.88430 WP_001052491.1.88440 WP_001052491.1.88445 WP_001052491.1.88449 WP_001052491.1.88455 WP_001052491.1.8847 WP_001052491.1.88471 WP_001052491.1.88473 WP_001052491.1.88478 WP_001052491.1.88480 WP_001052491.1.88490 WP_001052491.1.88498 WP_001052491.1.88504 WP_001052491.1.88518 WP_001052491.1.88536 WP_001052491.1.88555 WP_001052491.1.88558 WP_001052491.1.88560 WP_001052491.1.88563 WP_001052491.1.8857 WP_001052491.1.88572 WP_001052491.1.88580 WP_001052491.1.88583 WP_001052491.1.88585 WP_001052491.1.8859 WP_001052491.1.88599 WP_001052491.1.88600 WP_001052491.1.88614 WP_001052491.1.88623 WP_001052491.1.88636 WP_001052491.1.88638 WP_001052491.1.88642 WP_001052491.1.88671 WP_001052491.1.88694 WP_001052491.1.88696 WP_001052491.1.8872 WP_001052491.1.88738 WP_001052491.1.88739 WP_001052491.1.88753 WP_001052491.1.88761 WP_001052491.1.8877 WP_001052491.1.88771 WP_001052491.1.88781 WP_001052491.1.88805 WP_001052491.1.88827 WP_001052491.1.88843 WP_001052491.1.88856 WP_001052491.1.88859 WP_001052491.1.8886 WP_001052491.1.88861 WP_001052491.1.88871 WP_001052491.1.88874 WP_001052491.1.88878 WP_001052491.1.8888 WP_001052491.1.88881 WP_001052491.1.88897 WP_001052491.1.88912 WP_001052491.1.88922 WP_001052491.1.88934 WP_001052491.1.88954 WP_001052491.1.88959 WP_001052491.1.88960 WP_001052491.1.88962 WP_001052491.1.88987 WP_001052491.1.8900 WP_001052491.1.89012 WP_001052491.1.89024 WP_001052491.1.89027 WP_001052491.1.89036 WP_001052491.1.8904 WP_001052491.1.89070 WP_001052491.1.89086 WP_001052491.1.89103 WP_001052491.1.89108 WP_001052491.1.89125 WP_001052491.1.8913 WP_001052491.1.89133 WP_001052491.1.89139 WP_001052491.1.89164 WP_001052491.1.89173 WP_001052491.1.8918 WP_001052491.1.89181 WP_001052491.1.89184 WP_001052491.1.89194 WP_001052491.1.89195 WP_001052491.1.89204 WP_001052491.1.89216 WP_001052491.1.89229 WP_001052491.1.89235 WP_001052491.1.89237 WP_001052491.1.8924 WP_001052491.1.89258 WP_001052491.1.89262 WP_001052491.1.89284 WP_001052491.1.8929 WP_001052491.1.89347 WP_001052491.1.89348 WP_001052491.1.89350 WP_001052491.1.89372 WP_001052491.1.89390 WP_001052491.1.89404 WP_001052491.1.89414 WP_001052491.1.89433 WP_001052491.1.89439 WP_001052491.1.89476 WP_001052491.1.8950 WP_001052491.1.89516 WP_001052491.1.8953 WP_001052491.1.89537 WP_001052491.1.89544 WP_001052491.1.89545 WP_001052491.1.89556 WP_001052491.1.89557 WP_001052491.1.89559 WP_001052491.1.89594 WP_001052491.1.89603 WP_001052491.1.89628 WP_001052491.1.89651 WP_001052491.1.89655 WP_001052491.1.89672 WP_001052491.1.89678 WP_001052491.1.89686 WP_001052491.1.897 WP_001052491.1.89715 WP_001052491.1.89717 WP_001052491.1.89726 WP_001052491.1.89730 WP_001052491.1.89738 WP_001052491.1.89754 WP_001052491.1.89779 WP_001052491.1.89794 WP_001052491.1.89799 WP_001052491.1.898 WP_001052491.1.89857 WP_001052491.1.8986 WP_001052491.1.89860 WP_001052491.1.89863 WP_001052491.1.89874 WP_001052491.1.89883 WP_001052491.1.8990 WP_001052491.1.89908 WP_001052491.1.89924 WP_001052491.1.89928 WP_001052491.1.89933 WP_001052491.1.89935 WP_001052491.1.89949 WP_001052491.1.89950 WP_001052491.1.89960 WP_001052491.1.90005 WP_001052491.1.90018 WP_001052491.1.90038 WP_001052491.1.90046 WP_001052491.1.90055 WP_001052491.1.90069 WP_001052491.1.90091 WP_001052491.1.90095 WP_001052491.1.90112 WP_001052491.1.90131 WP_001052491.1.90145 WP_001052491.1.90148 WP_001052491.1.90161 WP_001052491.1.90173 WP_001052491.1.90174 WP_001052491.1.90180 WP_001052491.1.90215 WP_001052491.1.90217 WP_001052491.1.9022 WP_001052491.1.90232 WP_001052491.1.90239 WP_001052491.1.90243 WP_001052491.1.90244 WP_001052491.1.90246 WP_001052491.1.90250 WP_001052491.1.90253 WP_001052491.1.90263 WP_001052491.1.90269 WP_001052491.1.90276 WP_001052491.1.9030 WP_001052491.1.90307 WP_001052491.1.90331 WP_001052491.1.90345 WP_001052491.1.90367 WP_001052491.1.90370 WP_001052491.1.90386 WP_001052491.1.90432 WP_001052491.1.90447 WP_001052491.1.90454 WP_001052491.1.90473 WP_001052491.1.90475 WP_001052491.1.90488 WP_001052491.1.90506 WP_001052491.1.90514 WP_001052491.1.90517 WP_001052491.1.90533 WP_001052491.1.90544 WP_001052491.1.90548 WP_001052491.1.9055 WP_001052491.1.90554 WP_001052491.1.90562 WP_001052491.1.90604 WP_001052491.1.90647 WP_001052491.1.90660 WP_001052491.1.90661 WP_001052491.1.90669 WP_001052491.1.90683 WP_001052491.1.90698 WP_001052491.1.9071 WP_001052491.1.90717 WP_001052491.1.90726 WP_001052491.1.90728 WP_001052491.1.90738 WP_001052491.1.9074 WP_001052491.1.90740 WP_001052491.1.90745 WP_001052491.1.90757 WP_001052491.1.9076 WP_001052491.1.90777 WP_001052491.1.90801 WP_001052491.1.90804 WP_001052491.1.90818 WP_001052491.1.90820 WP_001052491.1.90861 WP_001052491.1.90875 WP_001052491.1.90887 WP_001052491.1.90896 WP_001052491.1.90903 WP_001052491.1.90923 WP_001052491.1.90928 WP_001052491.1.90994 WP_001052491.1.9100 WP_001052491.1.91005 WP_001052491.1.91011 WP_001052491.1.91019 WP_001052491.1.91054 WP_001052491.1.91087 WP_001052491.1.91089 WP_001052491.1.91124 WP_001052491.1.91126 WP_001052491.1.9114 WP_001052491.1.91150 WP_001052491.1.91158 WP_001052491.1.91177 WP_001052491.1.91184 WP_001052491.1.912 WP_001052491.1.9122 WP_001052491.1.91233 WP_001052491.1.91246 WP_001052491.1.91252 WP_001052491.1.91258 WP_001052491.1.9127 WP_001052491.1.91279 WP_001052491.1.91280 WP_001052491.1.91287 WP_001052491.1.91297 WP_001052491.1.9130 WP_001052491.1.91300 WP_001052491.1.91310 WP_001052491.1.91316 WP_001052491.1.91332 WP_001052491.1.91346 WP_001052491.1.91357 WP_001052491.1.91364 WP_001052491.1.91365 WP_001052491.1.91371 WP_001052491.1.91380 WP_001052491.1.91382 WP_001052491.1.9140 WP_001052491.1.91420 WP_001052491.1.91427 WP_001052491.1.91447 WP_001052491.1.91465 WP_001052491.1.91486 WP_001052491.1.91487 WP_001052491.1.91500 WP_001052491.1.91501 WP_001052491.1.91525 WP_001052491.1.9153 WP_001052491.1.91530 WP_001052491.1.91542 WP_001052491.1.91547 WP_001052491.1.9155 WP_001052491.1.91559 WP_001052491.1.91573 WP_001052491.1.91581 WP_001052491.1.91586 WP_001052491.1.91587 WP_001052491.1.91591 WP_001052491.1.91611 WP_001052491.1.91624 WP_001052491.1.91629 WP_001052491.1.91634 WP_001052491.1.91635 WP_001052491.1.91639 WP_001052491.1.91660 WP_001052491.1.91670 WP_001052491.1.917 WP_001052491.1.91704 WP_001052491.1.91745 WP_001052491.1.91746 WP_001052491.1.91749 WP_001052491.1.91771 WP_001052491.1.91781 WP_001052491.1.91791 WP_001052491.1.91800 WP_001052491.1.91816 WP_001052491.1.91829 WP_001052491.1.91848 WP_001052491.1.91895 WP_001052491.1.91909 WP_001052491.1.91911 WP_001052491.1.91918 WP_001052491.1.91919 WP_001052491.1.91928 WP_001052491.1.91950 WP_001052491.1.91955 WP_001052491.1.91969 WP_001052491.1.92 WP_001052491.1.92055 WP_001052491.1.92057 WP_001052491.1.92080 WP_001052491.1.92104 WP_001052491.1.92110 WP_001052491.1.92115 WP_001052491.1.92125 WP_001052491.1.92133 WP_001052491.1.92140 WP_001052491.1.92143 WP_001052491.1.92147 WP_001052491.1.92158 WP_001052491.1.92164 WP_001052491.1.92169 WP_001052491.1.92173 WP_001052491.1.92185 WP_001052491.1.92186 WP_001052491.1.92196 WP_001052491.1.92199 WP_001052491.1.92212 WP_001052491.1.92218 WP_001052491.1.92227 WP_001052491.1.92228 WP_001052491.1.9224 WP_001052491.1.92244 WP_001052491.1.92249 WP_001052491.1.92253 WP_001052491.1.92254 WP_001052491.1.92259 WP_001052491.1.92278 WP_001052491.1.92297 WP_001052491.1.923 WP_001052491.1.92303 WP_001052491.1.92324 WP_001052491.1.9234 WP_001052491.1.92340 WP_001052491.1.9237 WP_001052491.1.9239 WP_001052491.1.92391 WP_001052491.1.92398 WP_001052491.1.92405 WP_001052491.1.92415 WP_001052491.1.92424 WP_001052491.1.92425 WP_001052491.1.92436 WP_001052491.1.92442 WP_001052491.1.9247 WP_001052491.1.92479 WP_001052491.1.92488 WP_001052491.1.92497 WP_001052491.1.92500 WP_001052491.1.92512 WP_001052491.1.92520 WP_001052491.1.92534 WP_001052491.1.92541 WP_001052491.1.92544 WP_001052491.1.92546 WP_001052491.1.92560 WP_001052491.1.92565 WP_001052491.1.92602 WP_001052491.1.92607 WP_001052491.1.92667 WP_001052491.1.92674 WP_001052491.1.92679 WP_001052491.1.92688 WP_001052491.1.92691 WP_001052491.1.92718 WP_001052491.1.92723 WP_001052491.1.92726 WP_001052491.1.92735 WP_001052491.1.92741 WP_001052491.1.92765 WP_001052491.1.92773 WP_001052491.1.92789 WP_001052491.1.92795 WP_001052491.1.92805 WP_001052491.1.92840 WP_001052491.1.92848 WP_001052491.1.92849 WP_001052491.1.9286 WP_001052491.1.92862 WP_001052491.1.92864 WP_001052491.1.92897 WP_001052491.1.92918 WP_001052491.1.9293 WP_001052491.1.92937 WP_001052491.1.92950 WP_001052491.1.9296 WP_001052491.1.92960 WP_001052491.1.92965 WP_001052491.1.9298 WP_001052491.1.92997 WP_001052491.1.93010 WP_001052491.1.93041 WP_001052491.1.93047 WP_001052491.1.9305 WP_001052491.1.93068 WP_001052491.1.93071 WP_001052491.1.93074 WP_001052491.1.93078 WP_001052491.1.93125 WP_001052491.1.93141 WP_001052491.1.93147 WP_001052491.1.93163 WP_001052491.1.93176 WP_001052491.1.93186 WP_001052491.1.93191 WP_001052491.1.93197 WP_001052491.1.93198 WP_001052491.1.93207 WP_001052491.1.93211 WP_001052491.1.93224 WP_001052491.1.93231 WP_001052491.1.93235 WP_001052491.1.93237 WP_001052491.1.93243 WP_001052491.1.93251 WP_001052491.1.93254 WP_001052491.1.93260 WP_001052491.1.93263 WP_001052491.1.93272 WP_001052491.1.93296 WP_001052491.1.9330 WP_001052491.1.93300 WP_001052491.1.93316 WP_001052491.1.93329 WP_001052491.1.93336 WP_001052491.1.93354 WP_001052491.1.93374 WP_001052491.1.93378 WP_001052491.1.93416 WP_001052491.1.93435 WP_001052491.1.93438 WP_001052491.1.93444 WP_001052491.1.9346 WP_001052491.1.93471 WP_001052491.1.93492 WP_001052491.1.93514 WP_001052491.1.9352 WP_001052491.1.93538 WP_001052491.1.9354 WP_001052491.1.93561 WP_001052491.1.93567 WP_001052491.1.93579 WP_001052491.1.9358 WP_001052491.1.93590 WP_001052491.1.93613 WP_001052491.1.93647 WP_001052491.1.93658 WP_001052491.1.93669 WP_001052491.1.93678 WP_001052491.1.93690 WP_001052491.1.9370 WP_001052491.1.93708 WP_001052491.1.93710 WP_001052491.1.93722 WP_001052491.1.93736 WP_001052491.1.93738 WP_001052491.1.93758 WP_001052491.1.93762 WP_001052491.1.93769 WP_001052491.1.93775 WP_001052491.1.93787 WP_001052491.1.93862 WP_001052491.1.9387 WP_001052491.1.93882 WP_001052491.1.93883 WP_001052491.1.93890 WP_001052491.1.93891 WP_001052491.1.9392 WP_001052491.1.93934 WP_001052491.1.93972 WP_001052491.1.93975 WP_001052491.1.93976 WP_001052491.1.9398 WP_001052491.1.93981 WP_001052491.1.94 WP_001052491.1.94009 WP_001052491.1.94016 WP_001052491.1.94053 WP_001052491.1.94060 WP_001052491.1.94074 WP_001052491.1.9408 WP_001052491.1.94080 WP_001052491.1.94082 WP_001052491.1.94087 WP_001052491.1.94093 WP_001052491.1.94096 WP_001052491.1.9411 WP_001052491.1.94114 WP_001052491.1.94119 WP_001052491.1.94122 WP_001052491.1.94123 WP_001052491.1.94130 WP_001052491.1.94165 WP_001052491.1.94172 WP_001052491.1.94182 WP_001052491.1.94209 WP_001052491.1.94229 WP_001052491.1.94242 WP_001052491.1.94245 WP_001052491.1.94248 WP_001052491.1.94268 WP_001052491.1.94287 WP_001052491.1.94293 WP_001052491.1.94294 WP_001052491.1.9430 WP_001052491.1.94319 WP_001052491.1.94320 WP_001052491.1.94324 WP_001052491.1.94325 WP_001052491.1.94335 WP_001052491.1.94337 WP_001052491.1.94340 WP_001052491.1.94341 WP_001052491.1.94345 WP_001052491.1.9435 WP_001052491.1.9437 WP_001052491.1.94374 WP_001052491.1.94375 WP_001052491.1.94376 WP_001052491.1.94389 WP_001052491.1.94407 WP_001052491.1.94409 WP_001052491.1.94414 WP_001052491.1.94423 WP_001052491.1.94484 WP_001052491.1.94505 WP_001052491.1.94530 WP_001052491.1.94536 WP_001052491.1.94549 WP_001052491.1.9455 WP_001052491.1.94550 WP_001052491.1.94576 WP_001052491.1.94625 WP_001052491.1.94636 WP_001052491.1.9464 WP_001052491.1.94641 WP_001052491.1.94684 WP_001052491.1.94688 WP_001052491.1.947 WP_001052491.1.94719 WP_001052491.1.94733 WP_001052491.1.94741 WP_001052491.1.94789 WP_001052491.1.94797 WP_001052491.1.94805 WP_001052491.1.94825 WP_001052491.1.94838 WP_001052491.1.94844 WP_001052491.1.94845 WP_001052491.1.9485 WP_001052491.1.94857 WP_001052491.1.94866 WP_001052491.1.94941 WP_001052491.1.9495 WP_001052491.1.94958 WP_001052491.1.94969 WP_001052491.1.9497 WP_001052491.1.94980 WP_001052491.1.94989 WP_001052491.1.94992 WP_001052491.1.94999 WP_001052491.1.95002 WP_001052491.1.95008 WP_001052491.1.95014 WP_001052491.1.95023 WP_001052491.1.95029 WP_001052491.1.95033 WP_001052491.1.95038 WP_001052491.1.95049 WP_001052491.1.95075 WP_001052491.1.95077 WP_001052491.1.95090 WP_001052491.1.9510 WP_001052491.1.95120 WP_001052491.1.95154 WP_001052491.1.95156 WP_001052491.1.95174 WP_001052491.1.95193 WP_001052491.1.95210 WP_001052491.1.95263 WP_001052491.1.95281 WP_001052491.1.95294 WP_001052491.1.95304 WP_001052491.1.95307 WP_001052491.1.95318 WP_001052491.1.95327 WP_001052491.1.95342 WP_001052491.1.95361 WP_001052491.1.95372 WP_001052491.1.9538 WP_001052491.1.95386 WP_001052491.1.95409 WP_001052491.1.95415 WP_001052491.1.9544 WP_001052491.1.95442 WP_001052491.1.95452 WP_001052491.1.95476 WP_001052491.1.95494 WP_001052491.1.95495 WP_001052491.1.95500 WP_001052491.1.95505 WP_001052491.1.95512 WP_001052491.1.95519 WP_001052491.1.95522 WP_001052491.1.95535 WP_001052491.1.95537 WP_001052491.1.95545 WP_001052491.1.95550 WP_001052491.1.95552 WP_001052491.1.95560 WP_001052491.1.9557 WP_001052491.1.95571 WP_001052491.1.95581 WP_001052491.1.95603 WP_001052491.1.9563 WP_001052491.1.95631 WP_001052491.1.95639 WP_001052491.1.95640 WP_001052491.1.95681 WP_001052491.1.95683 WP_001052491.1.95699 WP_001052491.1.95704 WP_001052491.1.95713 WP_001052491.1.95714 WP_001052491.1.95737 WP_001052491.1.95760 WP_001052491.1.95780 WP_001052491.1.95781 WP_001052491.1.95804 WP_001052491.1.95806 WP_001052491.1.95832 WP_001052491.1.95877 WP_001052491.1.95885 WP_001052491.1.959 WP_001052491.1.95914 WP_001052491.1.95918 WP_001052491.1.95943 WP_001052491.1.95947 WP_001052491.1.95954 WP_001052491.1.95962 WP_001052491.1.95983 WP_001052491.1.95986 WP_001052491.1.95997 WP_001052491.1.96014 WP_001052491.1.96022 WP_001052491.1.96030 WP_001052491.1.96056 WP_001052491.1.96057 WP_001052491.1.96067 WP_001052491.1.96075 WP_001052491.1.96105 WP_001052491.1.96133 WP_001052491.1.96135 WP_001052491.1.96148 WP_001052491.1.96160 WP_001052491.1.96163 WP_001052491.1.96165 WP_001052491.1.9617 WP_001052491.1.96200 WP_001052491.1.96209 WP_001052491.1.96218 WP_001052491.1.96221 WP_001052491.1.96228 WP_001052491.1.96255 WP_001052491.1.96261 WP_001052491.1.96271 WP_001052491.1.96280 WP_001052491.1.96283 WP_001052491.1.96297 WP_001052491.1.96301 WP_001052491.1.96305 WP_001052491.1.96312 WP_001052491.1.96314 WP_001052491.1.96316 WP_001052491.1.96322 WP_001052491.1.96334 WP_001052491.1.96362 WP_001052491.1.96364 WP_001052491.1.96368 WP_001052491.1.96412 WP_001052491.1.96424 WP_001052491.1.96433 WP_001052491.1.96468 WP_001052491.1.96472 WP_001052491.1.96474 WP_001052491.1.96477 WP_001052491.1.96489 WP_001052491.1.96495 WP_001052491.1.9650 WP_001052491.1.96509 WP_001052491.1.96535 WP_001052491.1.96538 WP_001052491.1.96548 WP_001052491.1.96550 WP_001052491.1.96554 WP_001052491.1.96566 WP_001052491.1.96568 WP_001052491.1.96577 WP_001052491.1.96578 WP_001052491.1.96591 WP_001052491.1.96603 WP_001052491.1.96613 WP_001052491.1.96628 WP_001052491.1.96634 WP_001052491.1.96637 WP_001052491.1.96638 WP_001052491.1.96646 WP_001052491.1.96654 WP_001052491.1.96663 WP_001052491.1.96678 WP_001052491.1.96682 WP_001052491.1.96688 WP_001052491.1.96699 WP_001052491.1.96705 WP_001052491.1.96718 WP_001052491.1.96727 WP_001052491.1.9675 WP_001052491.1.96770 WP_001052491.1.96780 WP_001052491.1.96804 WP_001052491.1.96836 WP_001052491.1.9684 WP_001052491.1.96854 WP_001052491.1.96855 WP_001052491.1.96856 WP_001052491.1.96859 WP_001052491.1.96866 WP_001052491.1.96882 WP_001052491.1.96892 WP_001052491.1.96895 WP_001052491.1.96918 WP_001052491.1.9692 WP_001052491.1.96922 WP_001052491.1.96928 WP_001052491.1.9695 WP_001052491.1.96956 WP_001052491.1.96965 WP_001052491.1.96969 WP_001052491.1.96970 WP_001052491.1.96976 WP_001052491.1.96985 WP_001052491.1.96997 WP_001052491.1.97001 WP_001052491.1.97004 WP_001052491.1.97007 WP_001052491.1.97014 WP_001052491.1.97017 WP_001052491.1.97019 WP_001052491.1.97029 WP_001052491.1.97033 WP_001052491.1.97034 WP_001052491.1.97072 WP_001052491.1.97077 WP_001052491.1.97117 WP_001052491.1.97138 WP_001052491.1.97139 WP_001052491.1.97141 WP_001052491.1.97146 WP_001052491.1.97151 WP_001052491.1.97161 WP_001052491.1.97191 WP_001052491.1.97205 WP_001052491.1.97206 WP_001052491.1.97228 WP_001052491.1.97230 WP_001052491.1.97234 WP_001052491.1.97241 WP_001052491.1.9725 WP_001052491.1.97256 WP_001052491.1.97267 WP_001052491.1.97276 WP_001052491.1.97293 WP_001052491.1.97295 WP_001052491.1.97302 WP_001052491.1.97311 WP_001052491.1.97312 WP_001052491.1.97336 WP_001052491.1.97348 WP_001052491.1.97352 WP_001052491.1.97355 WP_001052491.1.97367 WP_001052491.1.9737 WP_001052491.1.97392 WP_001052491.1.97399 WP_001052491.1.97409 WP_001052491.1.97411 WP_001052491.1.97427 WP_001052491.1.9743 WP_001052491.1.97444 WP_001052491.1.97450 WP_001052491.1.97456 WP_001052491.1.97460 WP_001052491.1.97466 WP_001052491.1.97468 WP_001052491.1.9748 WP_001052491.1.97484 WP_001052491.1.97494 WP_001052491.1.97530 WP_001052491.1.97531 WP_001052491.1.97536 WP_001052491.1.97537 WP_001052491.1.97574 WP_001052491.1.97575 WP_001052491.1.97576 WP_001052491.1.9758 WP_001052491.1.97585 WP_001052491.1.97590 WP_001052491.1.97627 WP_001052491.1.97641 WP_001052491.1.97664 WP_001052491.1.97687 WP_001052491.1.97688 WP_001052491.1.97696 WP_001052491.1.97699 WP_001052491.1.97706 WP_001052491.1.97717 WP_001052491.1.97720 WP_001052491.1.97729 WP_001052491.1.97731 WP_001052491.1.97739 WP_001052491.1.97742 WP_001052491.1.97744 WP_001052491.1.97746 WP_001052491.1.97758 WP_001052491.1.97762 WP_001052491.1.97763 WP_001052491.1.97776 WP_001052491.1.97786 WP_001052491.1.97827 WP_001052491.1.97835 WP_001052491.1.9788 WP_001052491.1.9789 WP_001052491.1.97898 WP_001052491.1.97899 WP_001052491.1.97928 WP_001052491.1.97935 WP_001052491.1.97953 WP_001052491.1.97955 WP_001052491.1.97967 WP_001052491.1.97974 WP_001052491.1.97997 WP_001052491.1.97999 WP_001052491.1.98008 WP_001052491.1.98011 WP_001052491.1.98033 WP_001052491.1.98051 WP_001052491.1.98054 WP_001052491.1.98058 WP_001052491.1.98073 WP_001052491.1.98077 WP_001052491.1.98131 WP_001052491.1.98161 WP_001052491.1.98174 WP_001052491.1.98179 WP_001052491.1.98191 WP_001052491.1.98195 WP_001052491.1.98233 WP_001052491.1.98242 WP_001052491.1.98248 WP_001052491.1.98249 WP_001052491.1.98281 WP_001052491.1.98295 WP_001052491.1.98307 WP_001052491.1.98322 WP_001052491.1.98328 WP_001052491.1.98352 WP_001052491.1.98353 WP_001052491.1.98359 WP_001052491.1.98360 WP_001052491.1.98361 WP_001052491.1.98366 WP_001052491.1.98372 WP_001052491.1.98379 WP_001052491.1.98387 WP_001052491.1.98394 WP_001052491.1.98409 WP_001052491.1.98411 WP_001052491.1.98415 WP_001052491.1.98419 WP_001052491.1.98425 WP_001052491.1.98497 WP_001052491.1.98501 WP_001052491.1.98506 WP_001052491.1.98510 WP_001052491.1.98512 WP_001052491.1.98533 WP_001052491.1.98546 WP_001052491.1.98548 WP_001052491.1.98552 WP_001052491.1.98559 WP_001052491.1.98585 WP_001052491.1.98586 WP_001052491.1.986 WP_001052491.1.98609 WP_001052491.1.98655 WP_001052491.1.98659 WP_001052491.1.98667 WP_001052491.1.98703 WP_001052491.1.98706 WP_001052491.1.98710 WP_001052491.1.9872 WP_001052491.1.98723 WP_001052491.1.98730 WP_001052491.1.98734 WP_001052491.1.98741 WP_001052491.1.98750 WP_001052491.1.98767 WP_001052491.1.98786 WP_001052491.1.98797 WP_001052491.1.98805 WP_001052491.1.98807 WP_001052491.1.98821 WP_001052491.1.98825 WP_001052491.1.98837 WP_001052491.1.98842 WP_001052491.1.98858 WP_001052491.1.98865 WP_001052491.1.98874 WP_001052491.1.98880 WP_001052491.1.98883 WP_001052491.1.98894 WP_001052491.1.98912 WP_001052491.1.98924 WP_001052491.1.98967 WP_001052491.1.98978 WP_001052491.1.98981 WP_001052491.1.98985 WP_001052491.1.99009 WP_001052491.1.99025 WP_001052491.1.99027 WP_001052491.1.9903 WP_001052491.1.99081 WP_001052491.1.99090 WP_001052491.1.991 WP_001052491.1.9910 WP_001052491.1.99102 WP_001052491.1.9912 WP_001052491.1.99136 WP_001052491.1.99155 WP_001052491.1.99171 WP_001052491.1.99174 WP_001052491.1.99183 WP_001052491.1.99195 WP_001052491.1.99207 WP_001052491.1.99217 WP_001052491.1.99228 WP_001052491.1.99237 WP_001052491.1.99249 WP_001052491.1.99262 WP_001052491.1.99280 WP_001052491.1.99283 WP_001052491.1.99308 WP_001052491.1.99311 WP_001052491.1.99331 WP_001052491.1.99359 WP_001052491.1.9936 WP_001052491.1.99394 WP_001052491.1.99405 WP_001052491.1.99414 WP_001052491.1.99418 WP_001052491.1.99430 WP_001052491.1.99459 WP_001052491.1.99492 WP_001052491.1.99494 WP_001052491.1.99509 WP_001052491.1.99519 WP_001052491.1.99523 WP_001052491.1.99524 WP_001052491.1.99525 WP_001052491.1.99536 WP_001052491.1.99538 WP_001052491.1.99564 WP_001052491.1.99569 WP_001052491.1.9960 WP_001052491.1.99631 WP_001052491.1.99638 WP_001052491.1.9965 WP_001052491.1.99683 WP_001052491.1.99686 WP_001052491.1.99688 WP_001052491.1.99700 WP_001052491.1.99714 WP_001052491.1.9974 WP_001052491.1.99759 WP_001052491.1.99768 WP_001052491.1.99777 WP_001052491.1.99802 WP_001052491.1.99830 WP_001052491.1.99849 WP_001052491.1.9985 WP_001052491.1.99850 WP_001052491.1.99859 WP_001052491.1.99860 WP_001052491.1.99862 WP_001052491.1.9987 WP_001052491.1.99884 WP_001052491.1.99888 WP_001052491.1.99901 WP_001052491.1.99926 WP_001052491.1.99934 WP_001052491.1.99950 WP_001052491.1.99954 WP_001052491.1.99955 WP_001052491.1.99956 WP_001052491.1.99963 WP_001052491.1.99979 WP_001052491.1.99984 WP_001052491.1.99985 WP_001052491.1.99999 YP_500778.1.76163 gi|554644965|ref|YP_008716756.1| gi|150394581|ref|YP_001317256.1| gi|269203701|ref|YP_003282970.1| gi|385782307|ref|YP_005758478.1| gi|49484292|ref|YP_041516.1| gi|387143783|ref|YP_005732177.1| gi|514067034|ref|YP_008128954.1| gi|384550864|ref|YP_005740116.1| gi|161510278|ref|YP_001575937.1| gi|387781046|ref|YP_005755844.1| gi|87161266|ref|YP_494670.1| gi|532360130|ref|YP_008449959.1| jgi|Aspzo1|147575|fgenesh1_pg.32_#_57 gi|387151192|ref|YP_005742756.1| gi|384862719|ref|YP_005745439.1| gi|384865251|ref|YP_005750610.1| gi|148268518|ref|YP_001247461.1| gi|49486860|ref|YP_044081.1| gi|151222184|ref|YP_001333006.1| gi|386729753|ref|YP_006196136.1| 158878.SAV2066 158879.SA1871 196620.MW1990 282458.SAR2154 282459.SAS1971 359786.SaurJH9_2103 359787.SaurJH1_2140 418127.SAHV_2051 426430.NWMN_1972 451515.SAUSA300_2024 451516.USA300HOU_2061 681288.SAAV_2119 93061.SAOUHSC_02300 93062.SACOL2056 gi|156980382|ref|YP_001442641.1| gi|386831650|ref|YP_006238304.1| gi|15925056|ref|NP_372590.1| gi|384870617|ref|YP_005753331.1| gi|379015193|ref|YP_005291429.1| gi|545635432|ref|YP_008586002.1| gi|379796392|ref|YP_005326393.1| gi|57650738|ref|YP_186872.1| gi|88195966|ref|YP_500778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]