SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 359787.SaurJH1_2410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  359787.SaurJH1_2410
Domain Number - Region: 115-189
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0141
Family D-glucarate dehydratase-like 0.048
Further Details:      
 
Domain Number - Region: 176-252
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0369
Family ABC transporter transmembrane region 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 359787.SaurJH1_2410
Sequence length 410
Comment (Staphylococcus aureus JH1)
Sequence
MHKFWATFTLTYIKKIKAKSFVIFMIIIAALMIGLSNIDKIINMFDDGPDKIGVAAPNEQ
IYKVFKQQANTFHSDAKFTKVSIEDAEKEVKKHKLDKAYIIKVNQNRTLQGTIISEKRVS
HEDSQKVQALLTAIQTNMVAGELNINKEDLQKLQAQSKVDNKVISNDEVDKVSEGQKIFN
YALAYGIIFLMFFIVLNYASQIAMEIASEKTSRVIEMIITSISPIQHIFAKILGVIAVAV
TQIILIVLMAVICIFAFDLKDLLQGFNVEMNQLSWQIIIVGIISSIVGIMAYVLLAAILG
SLTSRIEDLNQSLMPLTLLGMIAFYIAIFTINNPDGQLALITSYIPFLAPFQLVVRAQTS
GLQIYEVILSSLISIVMVAVLIWIAIKTYKDSVLTFERGLFNSMKRVFKK
Download sequence
Identical sequences A0A0H3JMG9 A0A0H3JTA1 A0A181ETN1
gi|15925330|ref|NP_372864.1| gi|15927920|ref|NP_375453.1| 158878.SAV2340 158879.SA2131 359786.SaurJH9_2365 359787.SaurJH1_2410 418127.SAHV_2324 681288.SAAV_2405 gi|148268778|ref|YP_001247721.1| ZR293 gi|269203972|ref|YP_003283241.1| gi|384865521|ref|YP_005750880.1| gi|156980655|ref|YP_001442914.1| gi|387151464|ref|YP_005743028.1| WP_000548702.1.100122 WP_000548702.1.10014 WP_000548702.1.100171 WP_000548702.1.100184 WP_000548702.1.100235 WP_000548702.1.10032 WP_000548702.1.100366 WP_000548702.1.100399 WP_000548702.1.10046 WP_000548702.1.100464 WP_000548702.1.10050 WP_000548702.1.100535 WP_000548702.1.100562 WP_000548702.1.100582 WP_000548702.1.100596 WP_000548702.1.100665 WP_000548702.1.100693 WP_000548702.1.100699 WP_000548702.1.100704 WP_000548702.1.100719 WP_000548702.1.100823 WP_000548702.1.100832 WP_000548702.1.100860 WP_000548702.1.100888 WP_000548702.1.100934 WP_000548702.1.10097 WP_000548702.1.101002 WP_000548702.1.101019 WP_000548702.1.101027 WP_000548702.1.101068 WP_000548702.1.101071 WP_000548702.1.101072 WP_000548702.1.101103 WP_000548702.1.10111 WP_000548702.1.101160 WP_000548702.1.101192 WP_000548702.1.101262 WP_000548702.1.101379 WP_000548702.1.101414 WP_000548702.1.101440 WP_000548702.1.101441 WP_000548702.1.10148 WP_000548702.1.101567 WP_000548702.1.10165 WP_000548702.1.101661 WP_000548702.1.101691 WP_000548702.1.101704 WP_000548702.1.101728 WP_000548702.1.101745 WP_000548702.1.101778 WP_000548702.1.101813 WP_000548702.1.101820 WP_000548702.1.101825 WP_000548702.1.101852 WP_000548702.1.101902 WP_000548702.1.101906 WP_000548702.1.101943 WP_000548702.1.102065 WP_000548702.1.102096 WP_000548702.1.102123 WP_000548702.1.102130 WP_000548702.1.102132 WP_000548702.1.10238 WP_000548702.1.1025 WP_000548702.1.10274 WP_000548702.1.1031 WP_000548702.1.10343 WP_000548702.1.1043 WP_000548702.1.10478 WP_000548702.1.10481 WP_000548702.1.10526 WP_000548702.1.10583 WP_000548702.1.10624 WP_000548702.1.10749 WP_000548702.1.10751 WP_000548702.1.1077 WP_000548702.1.10823 WP_000548702.1.10858 WP_000548702.1.10919 WP_000548702.1.10928 WP_000548702.1.10942 WP_000548702.1.10976 WP_000548702.1.10979 WP_000548702.1.11001 WP_000548702.1.11069 WP_000548702.1.11073 WP_000548702.1.11083 WP_000548702.1.11084 WP_000548702.1.1115 WP_000548702.1.11162 WP_000548702.1.11220 WP_000548702.1.11261 WP_000548702.1.11282 WP_000548702.1.11286 WP_000548702.1.11322 WP_000548702.1.11333 WP_000548702.1.11378 WP_000548702.1.11403 WP_000548702.1.11447 WP_000548702.1.11451 WP_000548702.1.1147 WP_000548702.1.11504 WP_000548702.1.11513 WP_000548702.1.11556 WP_000548702.1.11611 WP_000548702.1.11640 WP_000548702.1.11646 WP_000548702.1.11663 WP_000548702.1.1171 WP_000548702.1.11730 WP_000548702.1.11736 WP_000548702.1.11768 WP_000548702.1.11794 WP_000548702.1.11816 WP_000548702.1.11837 WP_000548702.1.11884 WP_000548702.1.11903 WP_000548702.1.12042 WP_000548702.1.1210 WP_000548702.1.12149 WP_000548702.1.12152 WP_000548702.1.12170 WP_000548702.1.12175 WP_000548702.1.12234 WP_000548702.1.12256 WP_000548702.1.12330 WP_000548702.1.12437 WP_000548702.1.12508 WP_000548702.1.1257 WP_000548702.1.12598 WP_000548702.1.12608 WP_000548702.1.12618 WP_000548702.1.12685 WP_000548702.1.12733 WP_000548702.1.12737 WP_000548702.1.12770 WP_000548702.1.12780 WP_000548702.1.12788 WP_000548702.1.12829 WP_000548702.1.12858 WP_000548702.1.12884 WP_000548702.1.12904 WP_000548702.1.12918 WP_000548702.1.12920 WP_000548702.1.13013 WP_000548702.1.13062 WP_000548702.1.13154 WP_000548702.1.13169 WP_000548702.1.13189 WP_000548702.1.13243 WP_000548702.1.13250 WP_000548702.1.13326 WP_000548702.1.13355 WP_000548702.1.13379 WP_000548702.1.13405 WP_000548702.1.13448 WP_000548702.1.13514 WP_000548702.1.13554 WP_000548702.1.13612 WP_000548702.1.13665 WP_000548702.1.13668 WP_000548702.1.13670 WP_000548702.1.13879 WP_000548702.1.13897 WP_000548702.1.13933 WP_000548702.1.13986 WP_000548702.1.13987 WP_000548702.1.14025 WP_000548702.1.14076 WP_000548702.1.14097 WP_000548702.1.14143 WP_000548702.1.14163 WP_000548702.1.1420 WP_000548702.1.14201 WP_000548702.1.1425 WP_000548702.1.1429 WP_000548702.1.14305 WP_000548702.1.14342 WP_000548702.1.14358 WP_000548702.1.14397 WP_000548702.1.14412 WP_000548702.1.14535 WP_000548702.1.14577 WP_000548702.1.14596 WP_000548702.1.14639 WP_000548702.1.14696 WP_000548702.1.1471 WP_000548702.1.14729 WP_000548702.1.14734 WP_000548702.1.14774 WP_000548702.1.14825 WP_000548702.1.14846 WP_000548702.1.14874 WP_000548702.1.14967 WP_000548702.1.14970 WP_000548702.1.15015 WP_000548702.1.15029 WP_000548702.1.15108 WP_000548702.1.15173 WP_000548702.1.15185 WP_000548702.1.1520 WP_000548702.1.15201 WP_000548702.1.1525 WP_000548702.1.15268 WP_000548702.1.15269 WP_000548702.1.15294 WP_000548702.1.15296 WP_000548702.1.15421 WP_000548702.1.15533 WP_000548702.1.15544 WP_000548702.1.15546 WP_000548702.1.1558 WP_000548702.1.1564 WP_000548702.1.15691 WP_000548702.1.15722 WP_000548702.1.15785 WP_000548702.1.15812 WP_000548702.1.159 WP_000548702.1.15920 WP_000548702.1.15921 WP_000548702.1.15925 WP_000548702.1.16018 WP_000548702.1.16068 WP_000548702.1.16096 WP_000548702.1.16098 WP_000548702.1.16140 WP_000548702.1.16173 WP_000548702.1.16195 WP_000548702.1.16203 WP_000548702.1.16223 WP_000548702.1.1623 WP_000548702.1.16251 WP_000548702.1.16265 WP_000548702.1.16276 WP_000548702.1.16311 WP_000548702.1.16395 WP_000548702.1.16407 WP_000548702.1.16455 WP_000548702.1.16458 WP_000548702.1.16467 WP_000548702.1.16589 WP_000548702.1.16632 WP_000548702.1.16639 WP_000548702.1.1665 WP_000548702.1.16651 WP_000548702.1.16653 WP_000548702.1.16693 WP_000548702.1.16747 WP_000548702.1.16761 WP_000548702.1.16794 WP_000548702.1.16815 WP_000548702.1.16824 WP_000548702.1.16880 WP_000548702.1.16882 WP_000548702.1.16920 WP_000548702.1.16969 WP_000548702.1.17046 WP_000548702.1.17080 WP_000548702.1.17122 WP_000548702.1.17132 WP_000548702.1.17139 WP_000548702.1.17157 WP_000548702.1.17180 WP_000548702.1.17240 WP_000548702.1.17289 WP_000548702.1.1729 WP_000548702.1.17309 WP_000548702.1.17327 WP_000548702.1.1736 WP_000548702.1.1741 WP_000548702.1.17419 WP_000548702.1.17454 WP_000548702.1.17529 WP_000548702.1.17531 WP_000548702.1.1756 WP_000548702.1.17590 WP_000548702.1.17643 WP_000548702.1.1765 WP_000548702.1.17671 WP_000548702.1.17717 WP_000548702.1.17718 WP_000548702.1.17725 WP_000548702.1.17737 WP_000548702.1.17796 WP_000548702.1.17818 WP_000548702.1.17832 WP_000548702.1.17847 WP_000548702.1.17853 WP_000548702.1.17909 WP_000548702.1.17922 WP_000548702.1.17943 WP_000548702.1.17987 WP_000548702.1.18011 WP_000548702.1.18069 WP_000548702.1.18080 WP_000548702.1.18113 WP_000548702.1.18140 WP_000548702.1.18153 WP_000548702.1.18203 WP_000548702.1.18248 WP_000548702.1.18261 WP_000548702.1.18288 WP_000548702.1.1829 WP_000548702.1.18301 WP_000548702.1.18309 WP_000548702.1.18310 WP_000548702.1.18360 WP_000548702.1.18429 WP_000548702.1.1847 WP_000548702.1.18487 WP_000548702.1.18506 WP_000548702.1.18507 WP_000548702.1.18539 WP_000548702.1.18560 WP_000548702.1.18570 WP_000548702.1.18591 WP_000548702.1.18632 WP_000548702.1.18679 WP_000548702.1.18741 WP_000548702.1.18777 WP_000548702.1.18792 WP_000548702.1.18818 WP_000548702.1.18819 WP_000548702.1.18834 WP_000548702.1.18882 WP_000548702.1.1892 WP_000548702.1.18965 WP_000548702.1.18968 WP_000548702.1.18974 WP_000548702.1.18996 WP_000548702.1.19052 WP_000548702.1.19082 WP_000548702.1.1911 WP_000548702.1.19301 WP_000548702.1.19322 WP_000548702.1.19399 WP_000548702.1.19430 WP_000548702.1.19450 WP_000548702.1.19537 WP_000548702.1.19555 WP_000548702.1.19577 WP_000548702.1.19611 WP_000548702.1.1964 WP_000548702.1.19643 WP_000548702.1.19701 WP_000548702.1.19725 WP_000548702.1.19732 WP_000548702.1.1974 WP_000548702.1.19748 WP_000548702.1.19788 WP_000548702.1.19792 WP_000548702.1.19816 WP_000548702.1.19848 WP_000548702.1.19891 WP_000548702.1.19912 WP_000548702.1.19921 WP_000548702.1.19980 WP_000548702.1.19981 WP_000548702.1.19982 WP_000548702.1.20006 WP_000548702.1.20049 WP_000548702.1.20052 WP_000548702.1.2007 WP_000548702.1.20078 WP_000548702.1.2008 WP_000548702.1.20090 WP_000548702.1.20100 WP_000548702.1.20156 WP_000548702.1.20161 WP_000548702.1.20167 WP_000548702.1.20191 WP_000548702.1.20214 WP_000548702.1.20245 WP_000548702.1.2029 WP_000548702.1.20324 WP_000548702.1.20340 WP_000548702.1.20394 WP_000548702.1.20398 WP_000548702.1.20399 WP_000548702.1.20411 WP_000548702.1.20447 WP_000548702.1.20479 WP_000548702.1.20487 WP_000548702.1.20574 WP_000548702.1.20579 WP_000548702.1.20585 WP_000548702.1.20611 WP_000548702.1.20619 WP_000548702.1.20620 WP_000548702.1.20649 WP_000548702.1.20661 WP_000548702.1.20736 WP_000548702.1.20796 WP_000548702.1.20821 WP_000548702.1.20846 WP_000548702.1.20867 WP_000548702.1.20878 WP_000548702.1.20913 WP_000548702.1.20922 WP_000548702.1.20935 WP_000548702.1.20939 WP_000548702.1.20945 WP_000548702.1.20971 WP_000548702.1.21009 WP_000548702.1.21056 WP_000548702.1.21066 WP_000548702.1.21078 WP_000548702.1.21109 WP_000548702.1.21111 WP_000548702.1.21154 WP_000548702.1.21183 WP_000548702.1.2119 WP_000548702.1.21257 WP_000548702.1.21272 WP_000548702.1.21313 WP_000548702.1.2135 WP_000548702.1.21359 WP_000548702.1.21375 WP_000548702.1.21393 WP_000548702.1.21449 WP_000548702.1.21464 WP_000548702.1.21480 WP_000548702.1.21500 WP_000548702.1.21514 WP_000548702.1.21572 WP_000548702.1.2159 WP_000548702.1.2160 WP_000548702.1.21621 WP_000548702.1.21636 WP_000548702.1.21724 WP_000548702.1.21746 WP_000548702.1.21763 WP_000548702.1.21787 WP_000548702.1.21830 WP_000548702.1.21988 WP_000548702.1.22027 WP_000548702.1.22082 WP_000548702.1.22111 WP_000548702.1.22177 WP_000548702.1.22197 WP_000548702.1.22227 WP_000548702.1.22302 WP_000548702.1.22400 WP_000548702.1.22493 WP_000548702.1.22533 WP_000548702.1.22559 WP_000548702.1.22650 WP_000548702.1.22696 WP_000548702.1.22702 WP_000548702.1.22738 WP_000548702.1.22789 WP_000548702.1.22790 WP_000548702.1.22792 WP_000548702.1.22803 WP_000548702.1.22853 WP_000548702.1.22861 WP_000548702.1.22869 WP_000548702.1.22890 WP_000548702.1.22969 WP_000548702.1.23008 WP_000548702.1.23061 WP_000548702.1.23082 WP_000548702.1.23103 WP_000548702.1.23121 WP_000548702.1.23130 WP_000548702.1.23132 WP_000548702.1.23133 WP_000548702.1.23161 WP_000548702.1.23185 WP_000548702.1.23197 WP_000548702.1.23222 WP_000548702.1.23244 WP_000548702.1.2327 WP_000548702.1.23275 WP_000548702.1.23288 WP_000548702.1.23413 WP_000548702.1.23439 WP_000548702.1.23449 WP_000548702.1.23531 WP_000548702.1.23580 WP_000548702.1.23630 WP_000548702.1.23644 WP_000548702.1.23690 WP_000548702.1.23740 WP_000548702.1.23796 WP_000548702.1.23809 WP_000548702.1.23842 WP_000548702.1.2389 WP_000548702.1.23900 WP_000548702.1.23902 WP_000548702.1.23956 WP_000548702.1.23972 WP_000548702.1.23995 WP_000548702.1.24000 WP_000548702.1.24129 WP_000548702.1.24174 WP_000548702.1.24207 WP_000548702.1.24213 WP_000548702.1.24263 WP_000548702.1.2427 WP_000548702.1.24277 WP_000548702.1.24343 WP_000548702.1.24416 WP_000548702.1.24437 WP_000548702.1.24469 WP_000548702.1.2450 WP_000548702.1.24589 WP_000548702.1.24596 WP_000548702.1.24602 WP_000548702.1.24631 WP_000548702.1.24679 WP_000548702.1.24823 WP_000548702.1.24855 WP_000548702.1.2497 WP_000548702.1.25007 WP_000548702.1.2501 WP_000548702.1.25012 WP_000548702.1.2506 WP_000548702.1.25070 WP_000548702.1.25092 WP_000548702.1.25095 WP_000548702.1.25098 WP_000548702.1.25115 WP_000548702.1.25145 WP_000548702.1.25167 WP_000548702.1.25209 WP_000548702.1.25287 WP_000548702.1.25361 WP_000548702.1.25459 WP_000548702.1.25489 WP_000548702.1.2552 WP_000548702.1.25557 WP_000548702.1.25595 WP_000548702.1.25621 WP_000548702.1.25633 WP_000548702.1.25721 WP_000548702.1.25758 WP_000548702.1.25772 WP_000548702.1.25779 WP_000548702.1.25802 WP_000548702.1.25840 WP_000548702.1.25856 WP_000548702.1.25857 WP_000548702.1.2590 WP_000548702.1.25910 WP_000548702.1.25930 WP_000548702.1.26039 WP_000548702.1.2608 WP_000548702.1.26086 WP_000548702.1.26106 WP_000548702.1.26143 WP_000548702.1.26169 WP_000548702.1.2621 WP_000548702.1.26255 WP_000548702.1.26266 WP_000548702.1.26276 WP_000548702.1.26290 WP_000548702.1.26298 WP_000548702.1.26314 WP_000548702.1.26318 WP_000548702.1.26340 WP_000548702.1.26345 WP_000548702.1.26354 WP_000548702.1.26359 WP_000548702.1.26364 WP_000548702.1.26399 WP_000548702.1.26404 WP_000548702.1.2643 WP_000548702.1.26506 WP_000548702.1.26662 WP_000548702.1.26677 WP_000548702.1.26692 WP_000548702.1.2673 WP_000548702.1.2674 WP_000548702.1.26751 WP_000548702.1.26772 WP_000548702.1.26804 WP_000548702.1.2684 WP_000548702.1.26840 WP_000548702.1.26865 WP_000548702.1.26884 WP_000548702.1.2689 WP_000548702.1.26903 WP_000548702.1.26905 WP_000548702.1.26938 WP_000548702.1.26944 WP_000548702.1.27013 WP_000548702.1.27053 WP_000548702.1.27083 WP_000548702.1.27166 WP_000548702.1.27170 WP_000548702.1.27182 WP_000548702.1.2719 WP_000548702.1.27262 WP_000548702.1.27294 WP_000548702.1.27323 WP_000548702.1.27379 WP_000548702.1.27387 WP_000548702.1.27447 WP_000548702.1.27456 WP_000548702.1.27468 WP_000548702.1.2753 WP_000548702.1.27539 WP_000548702.1.27590 WP_000548702.1.27628 WP_000548702.1.27646 WP_000548702.1.27689 WP_000548702.1.27739 WP_000548702.1.27744 WP_000548702.1.27765 WP_000548702.1.27793 WP_000548702.1.27830 WP_000548702.1.2795 WP_000548702.1.28016 WP_000548702.1.28091 WP_000548702.1.28105 WP_000548702.1.28173 WP_000548702.1.28213 WP_000548702.1.28226 WP_000548702.1.28230 WP_000548702.1.28253 WP_000548702.1.28257 WP_000548702.1.28274 WP_000548702.1.28315 WP_000548702.1.28319 WP_000548702.1.28347 WP_000548702.1.28400 WP_000548702.1.2852 WP_000548702.1.28578 WP_000548702.1.28580 WP_000548702.1.28605 WP_000548702.1.28652 WP_000548702.1.28690 WP_000548702.1.28720 WP_000548702.1.28763 WP_000548702.1.28784 WP_000548702.1.28785 WP_000548702.1.28848 WP_000548702.1.28871 WP_000548702.1.28981 WP_000548702.1.28987 WP_000548702.1.29052 WP_000548702.1.29060 WP_000548702.1.29112 WP_000548702.1.29155 WP_000548702.1.29166 WP_000548702.1.29187 WP_000548702.1.29226 WP_000548702.1.29242 WP_000548702.1.29263 WP_000548702.1.29276 WP_000548702.1.29329 WP_000548702.1.29366 WP_000548702.1.29368 WP_000548702.1.29420 WP_000548702.1.29468 WP_000548702.1.29522 WP_000548702.1.2957 WP_000548702.1.2972 WP_000548702.1.29736 WP_000548702.1.29744 WP_000548702.1.29788 WP_000548702.1.2981 WP_000548702.1.29826 WP_000548702.1.29862 WP_000548702.1.29902 WP_000548702.1.29905 WP_000548702.1.29918 WP_000548702.1.29981 WP_000548702.1.30051 WP_000548702.1.30089 WP_000548702.1.30095 WP_000548702.1.30100 WP_000548702.1.30152 WP_000548702.1.30186 WP_000548702.1.30197 WP_000548702.1.30204 WP_000548702.1.30209 WP_000548702.1.30249 WP_000548702.1.30302 WP_000548702.1.30307 WP_000548702.1.30328 WP_000548702.1.30364 WP_000548702.1.30508 WP_000548702.1.30531 WP_000548702.1.30560 WP_000548702.1.30645 WP_000548702.1.30646 WP_000548702.1.30666 WP_000548702.1.30702 WP_000548702.1.30720 WP_000548702.1.30726 WP_000548702.1.30763 WP_000548702.1.3077 WP_000548702.1.30845 WP_000548702.1.30847 WP_000548702.1.30854 WP_000548702.1.31005 WP_000548702.1.31022 WP_000548702.1.31039 WP_000548702.1.31048 WP_000548702.1.31091 WP_000548702.1.31176 WP_000548702.1.31204 WP_000548702.1.31206 WP_000548702.1.3123 WP_000548702.1.31315 WP_000548702.1.31337 WP_000548702.1.31339 WP_000548702.1.31355 WP_000548702.1.31436 WP_000548702.1.31437 WP_000548702.1.31442 WP_000548702.1.31468 WP_000548702.1.31479 WP_000548702.1.31529 WP_000548702.1.31539 WP_000548702.1.31621 WP_000548702.1.31642 WP_000548702.1.31647 WP_000548702.1.31653 WP_000548702.1.31686 WP_000548702.1.31753 WP_000548702.1.31828 WP_000548702.1.31842 WP_000548702.1.31892 WP_000548702.1.31931 WP_000548702.1.31997 WP_000548702.1.32003 WP_000548702.1.32005 WP_000548702.1.32029 WP_000548702.1.32040 WP_000548702.1.32067 WP_000548702.1.32160 WP_000548702.1.32207 WP_000548702.1.3229 WP_000548702.1.32339 WP_000548702.1.3242 WP_000548702.1.32474 WP_000548702.1.32481 WP_000548702.1.32483 WP_000548702.1.32514 WP_000548702.1.32534 WP_000548702.1.32565 WP_000548702.1.32607 WP_000548702.1.32645 WP_000548702.1.32746 WP_000548702.1.32764 WP_000548702.1.32770 WP_000548702.1.32800 WP_000548702.1.32928 WP_000548702.1.32954 WP_000548702.1.33038 WP_000548702.1.33048 WP_000548702.1.33110 WP_000548702.1.33123 WP_000548702.1.33138 WP_000548702.1.33172 WP_000548702.1.33212 WP_000548702.1.33250 WP_000548702.1.33266 WP_000548702.1.33292 WP_000548702.1.33296 WP_000548702.1.33335 WP_000548702.1.33357 WP_000548702.1.3341 WP_000548702.1.33416 WP_000548702.1.33432 WP_000548702.1.33468 WP_000548702.1.3347 WP_000548702.1.33507 WP_000548702.1.33594 WP_000548702.1.33626 WP_000548702.1.33627 WP_000548702.1.3363 WP_000548702.1.33640 WP_000548702.1.33654 WP_000548702.1.33692 WP_000548702.1.33695 WP_000548702.1.33718 WP_000548702.1.33735 WP_000548702.1.33743 WP_000548702.1.33769 WP_000548702.1.33792 WP_000548702.1.33804 WP_000548702.1.33813 WP_000548702.1.33966 WP_000548702.1.33968 WP_000548702.1.33971 WP_000548702.1.33983 WP_000548702.1.34026 WP_000548702.1.34030 WP_000548702.1.34051 WP_000548702.1.34062 WP_000548702.1.34080 WP_000548702.1.34100 WP_000548702.1.34132 WP_000548702.1.34182 WP_000548702.1.34209 WP_000548702.1.34244 WP_000548702.1.34250 WP_000548702.1.34251 WP_000548702.1.34280 WP_000548702.1.34285 WP_000548702.1.34381 WP_000548702.1.34403 WP_000548702.1.34410 WP_000548702.1.3448 WP_000548702.1.34482 WP_000548702.1.34492 WP_000548702.1.34502 WP_000548702.1.34510 WP_000548702.1.34526 WP_000548702.1.3461 WP_000548702.1.34677 WP_000548702.1.34737 WP_000548702.1.34767 WP_000548702.1.34818 WP_000548702.1.34890 WP_000548702.1.34918 WP_000548702.1.34998 WP_000548702.1.35059 WP_000548702.1.35062 WP_000548702.1.35089 WP_000548702.1.35097 WP_000548702.1.35110 WP_000548702.1.35121 WP_000548702.1.35233 WP_000548702.1.35276 WP_000548702.1.35285 WP_000548702.1.35297 WP_000548702.1.35334 WP_000548702.1.35342 WP_000548702.1.354 WP_000548702.1.35415 WP_000548702.1.3547 WP_000548702.1.35498 WP_000548702.1.35525 WP_000548702.1.35580 WP_000548702.1.35615 WP_000548702.1.35623 WP_000548702.1.35673 WP_000548702.1.3569 WP_000548702.1.35801 WP_000548702.1.35826 WP_000548702.1.35900 WP_000548702.1.35928 WP_000548702.1.35950 WP_000548702.1.36004 WP_000548702.1.36082 WP_000548702.1.36102 WP_000548702.1.36119 WP_000548702.1.36141 WP_000548702.1.3617 WP_000548702.1.36176 WP_000548702.1.36187 WP_000548702.1.36188 WP_000548702.1.36250 WP_000548702.1.36264 WP_000548702.1.36278 WP_000548702.1.36282 WP_000548702.1.36307 WP_000548702.1.36344 WP_000548702.1.36389 WP_000548702.1.36535 WP_000548702.1.3655 WP_000548702.1.36570 WP_000548702.1.36580 WP_000548702.1.36600 WP_000548702.1.36615 WP_000548702.1.36646 WP_000548702.1.3666 WP_000548702.1.36689 WP_000548702.1.36697 WP_000548702.1.36745 WP_000548702.1.3675 WP_000548702.1.36783 WP_000548702.1.36796 WP_000548702.1.36822 WP_000548702.1.3685 WP_000548702.1.36858 WP_000548702.1.3687 WP_000548702.1.36955 WP_000548702.1.36979 WP_000548702.1.36997 WP_000548702.1.37002 WP_000548702.1.37016 WP_000548702.1.3703 WP_000548702.1.37044 WP_000548702.1.37055 WP_000548702.1.37075 WP_000548702.1.37080 WP_000548702.1.37121 WP_000548702.1.37134 WP_000548702.1.37220 WP_000548702.1.37341 WP_000548702.1.37398 WP_000548702.1.37424 WP_000548702.1.37467 WP_000548702.1.37583 WP_000548702.1.37602 WP_000548702.1.37605 WP_000548702.1.37606 WP_000548702.1.37621 WP_000548702.1.37624 WP_000548702.1.3776 WP_000548702.1.37781 WP_000548702.1.37815 WP_000548702.1.37828 WP_000548702.1.37953 WP_000548702.1.37987 WP_000548702.1.38038 WP_000548702.1.38070 WP_000548702.1.38082 WP_000548702.1.3809 WP_000548702.1.38160 WP_000548702.1.38177 WP_000548702.1.3820 WP_000548702.1.38230 WP_000548702.1.38232 WP_000548702.1.38276 WP_000548702.1.38282 WP_000548702.1.38309 WP_000548702.1.38339 WP_000548702.1.38383 WP_000548702.1.3842 WP_000548702.1.38422 WP_000548702.1.38435 WP_000548702.1.38437 WP_000548702.1.38453 WP_000548702.1.38493 WP_000548702.1.38522 WP_000548702.1.38546 WP_000548702.1.38607 WP_000548702.1.38612 WP_000548702.1.3867 WP_000548702.1.38674 WP_000548702.1.38721 WP_000548702.1.38823 WP_000548702.1.38841 WP_000548702.1.38858 WP_000548702.1.38926 WP_000548702.1.38931 WP_000548702.1.38940 WP_000548702.1.38941 WP_000548702.1.38972 WP_000548702.1.38989 WP_000548702.1.39012 WP_000548702.1.39014 WP_000548702.1.39043 WP_000548702.1.39053 WP_000548702.1.3906 WP_000548702.1.391 WP_000548702.1.39108 WP_000548702.1.39203 WP_000548702.1.39206 WP_000548702.1.39217 WP_000548702.1.3926 WP_000548702.1.39272 WP_000548702.1.39290 WP_000548702.1.39324 WP_000548702.1.39332 WP_000548702.1.39333 WP_000548702.1.39384 WP_000548702.1.39397 WP_000548702.1.39406 WP_000548702.1.39486 WP_000548702.1.39494 WP_000548702.1.39506 WP_000548702.1.39550 WP_000548702.1.39645 WP_000548702.1.39687 WP_000548702.1.39689 WP_000548702.1.39697 WP_000548702.1.39711 WP_000548702.1.39738 WP_000548702.1.39767 WP_000548702.1.39789 WP_000548702.1.39832 WP_000548702.1.39838 WP_000548702.1.39856 WP_000548702.1.39869 WP_000548702.1.40014 WP_000548702.1.40043 WP_000548702.1.40082 WP_000548702.1.40099 WP_000548702.1.40120 WP_000548702.1.40137 WP_000548702.1.4015 WP_000548702.1.40164 WP_000548702.1.40173 WP_000548702.1.4019 WP_000548702.1.40318 WP_000548702.1.40320 WP_000548702.1.40330 WP_000548702.1.40342 WP_000548702.1.40368 WP_000548702.1.40406 WP_000548702.1.4045 WP_000548702.1.40474 WP_000548702.1.40481 WP_000548702.1.40505 WP_000548702.1.40531 WP_000548702.1.40532 WP_000548702.1.4056 WP_000548702.1.40579 WP_000548702.1.40588 WP_000548702.1.40620 WP_000548702.1.40644 WP_000548702.1.40655 WP_000548702.1.40658 WP_000548702.1.40659 WP_000548702.1.40797 WP_000548702.1.40816 WP_000548702.1.41064 WP_000548702.1.41084 WP_000548702.1.41094 WP_000548702.1.41119 WP_000548702.1.41129 WP_000548702.1.4115 WP_000548702.1.41178 WP_000548702.1.41208 WP_000548702.1.41241 WP_000548702.1.41255 WP_000548702.1.41289 WP_000548702.1.4129 WP_000548702.1.41426 WP_000548702.1.41432 WP_000548702.1.41433 WP_000548702.1.41499 WP_000548702.1.41558 WP_000548702.1.41567 WP_000548702.1.41582 WP_000548702.1.41674 WP_000548702.1.41839 WP_000548702.1.4188 WP_000548702.1.41898 WP_000548702.1.41935 WP_000548702.1.41943 WP_000548702.1.41983 WP_000548702.1.41989 WP_000548702.1.420 WP_000548702.1.42015 WP_000548702.1.42017 WP_000548702.1.42028 WP_000548702.1.42087 WP_000548702.1.42125 WP_000548702.1.42137 WP_000548702.1.42198 WP_000548702.1.42230 WP_000548702.1.42269 WP_000548702.1.42286 WP_000548702.1.42305 WP_000548702.1.42355 WP_000548702.1.42403 WP_000548702.1.42436 WP_000548702.1.42459 WP_000548702.1.42481 WP_000548702.1.42510 WP_000548702.1.42593 WP_000548702.1.426 WP_000548702.1.42640 WP_000548702.1.42652 WP_000548702.1.42668 WP_000548702.1.42674 WP_000548702.1.42679 WP_000548702.1.42737 WP_000548702.1.42759 WP_000548702.1.42786 WP_000548702.1.42837 WP_000548702.1.4293 WP_000548702.1.4299 WP_000548702.1.43014 WP_000548702.1.43047 WP_000548702.1.43072 WP_000548702.1.43122 WP_000548702.1.43131 WP_000548702.1.43134 WP_000548702.1.43143 WP_000548702.1.43147 WP_000548702.1.43159 WP_000548702.1.43165 WP_000548702.1.43202 WP_000548702.1.43248 WP_000548702.1.4325 WP_000548702.1.43263 WP_000548702.1.4327 WP_000548702.1.43274 WP_000548702.1.43323 WP_000548702.1.43341 WP_000548702.1.43349 WP_000548702.1.43369 WP_000548702.1.4337 WP_000548702.1.43406 WP_000548702.1.4341 WP_000548702.1.43460 WP_000548702.1.4347 WP_000548702.1.43550 WP_000548702.1.43560 WP_000548702.1.43618 WP_000548702.1.43627 WP_000548702.1.43659 WP_000548702.1.43670 WP_000548702.1.43702 WP_000548702.1.43703 WP_000548702.1.4372 WP_000548702.1.43731 WP_000548702.1.43752 WP_000548702.1.43788 WP_000548702.1.43819 WP_000548702.1.43827 WP_000548702.1.4385 WP_000548702.1.43904 WP_000548702.1.43915 WP_000548702.1.43964 WP_000548702.1.43984 WP_000548702.1.44095 WP_000548702.1.44119 WP_000548702.1.44153 WP_000548702.1.44181 WP_000548702.1.44195 WP_000548702.1.44265 WP_000548702.1.44302 WP_000548702.1.44388 WP_000548702.1.44396 WP_000548702.1.44405 WP_000548702.1.44420 WP_000548702.1.44544 WP_000548702.1.44579 WP_000548702.1.44588 WP_000548702.1.44605 WP_000548702.1.44631 WP_000548702.1.44672 WP_000548702.1.44732 WP_000548702.1.44755 WP_000548702.1.44785 WP_000548702.1.44788 WP_000548702.1.44796 WP_000548702.1.44881 WP_000548702.1.44914 WP_000548702.1.44969 WP_000548702.1.45033 WP_000548702.1.45035 WP_000548702.1.45099 WP_000548702.1.4513 WP_000548702.1.45133 WP_000548702.1.45164 WP_000548702.1.45170 WP_000548702.1.45272 WP_000548702.1.45290 WP_000548702.1.45297 WP_000548702.1.453 WP_000548702.1.45364 WP_000548702.1.45431 WP_000548702.1.45439 WP_000548702.1.4550 WP_000548702.1.45560 WP_000548702.1.45670 WP_000548702.1.45703 WP_000548702.1.45730 WP_000548702.1.45734 WP_000548702.1.45768 WP_000548702.1.45771 WP_000548702.1.45780 WP_000548702.1.45833 WP_000548702.1.4584 WP_000548702.1.45852 WP_000548702.1.45897 WP_000548702.1.45954 WP_000548702.1.4598 WP_000548702.1.46003 WP_000548702.1.46005 WP_000548702.1.46021 WP_000548702.1.46055 WP_000548702.1.46087 WP_000548702.1.46168 WP_000548702.1.46208 WP_000548702.1.46222 WP_000548702.1.46228 WP_000548702.1.46259 WP_000548702.1.46276 WP_000548702.1.46289 WP_000548702.1.46330 WP_000548702.1.46334 WP_000548702.1.46362 WP_000548702.1.46368 WP_000548702.1.46380 WP_000548702.1.46401 WP_000548702.1.46422 WP_000548702.1.46465 WP_000548702.1.46543 WP_000548702.1.4662 WP_000548702.1.46660 WP_000548702.1.46664 WP_000548702.1.46670 WP_000548702.1.46676 WP_000548702.1.46692 WP_000548702.1.46702 WP_000548702.1.46703 WP_000548702.1.46752 WP_000548702.1.46765 WP_000548702.1.46881 WP_000548702.1.46908 WP_000548702.1.46925 WP_000548702.1.46937 WP_000548702.1.4696 WP_000548702.1.46983 WP_000548702.1.46995 WP_000548702.1.47051 WP_000548702.1.47090 WP_000548702.1.47128 WP_000548702.1.47153 WP_000548702.1.47159 WP_000548702.1.47163 WP_000548702.1.47187 WP_000548702.1.47211 WP_000548702.1.47216 WP_000548702.1.47258 WP_000548702.1.47269 WP_000548702.1.47279 WP_000548702.1.4728 WP_000548702.1.47290 WP_000548702.1.47294 WP_000548702.1.47306 WP_000548702.1.47328 WP_000548702.1.47331 WP_000548702.1.47381 WP_000548702.1.47399 WP_000548702.1.47406 WP_000548702.1.47426 WP_000548702.1.47432 WP_000548702.1.47439 WP_000548702.1.47560 WP_000548702.1.47618 WP_000548702.1.4767 WP_000548702.1.477 WP_000548702.1.47733 WP_000548702.1.47763 WP_000548702.1.47782 WP_000548702.1.47836 WP_000548702.1.47859 WP_000548702.1.47872 WP_000548702.1.47873 WP_000548702.1.47904 WP_000548702.1.47996 WP_000548702.1.48011 WP_000548702.1.48030 WP_000548702.1.48047 WP_000548702.1.4805 WP_000548702.1.48057 WP_000548702.1.48149 WP_000548702.1.4815 WP_000548702.1.48154 WP_000548702.1.48169 WP_000548702.1.48227 WP_000548702.1.48236 WP_000548702.1.48250 WP_000548702.1.48284 WP_000548702.1.48293 WP_000548702.1.48307 WP_000548702.1.48322 WP_000548702.1.48335 WP_000548702.1.48391 WP_000548702.1.48394 WP_000548702.1.48463 WP_000548702.1.48563 WP_000548702.1.48577 WP_000548702.1.48593 WP_000548702.1.48634 WP_000548702.1.48656 WP_000548702.1.4868 WP_000548702.1.48705 WP_000548702.1.48711 WP_000548702.1.48805 WP_000548702.1.48823 WP_000548702.1.48833 WP_000548702.1.48835 WP_000548702.1.4886 WP_000548702.1.48936 WP_000548702.1.48941 WP_000548702.1.48945 WP_000548702.1.48951 WP_000548702.1.48968 WP_000548702.1.48982 WP_000548702.1.48993 WP_000548702.1.4901 WP_000548702.1.4905 WP_000548702.1.49129 WP_000548702.1.49159 WP_000548702.1.4916 WP_000548702.1.49161 WP_000548702.1.4917 WP_000548702.1.49207 WP_000548702.1.49248 WP_000548702.1.49327 WP_000548702.1.49398 WP_000548702.1.49444 WP_000548702.1.4950 WP_000548702.1.4962 WP_000548702.1.49653 WP_000548702.1.49669 WP_000548702.1.49730 WP_000548702.1.49742 WP_000548702.1.4980 WP_000548702.1.49800 WP_000548702.1.49860 WP_000548702.1.49863 WP_000548702.1.49871 WP_000548702.1.4989 WP_000548702.1.49894 WP_000548702.1.49907 WP_000548702.1.49934 WP_000548702.1.4994 WP_000548702.1.49970 WP_000548702.1.49982 WP_000548702.1.50013 WP_000548702.1.50038 WP_000548702.1.50039 WP_000548702.1.50061 WP_000548702.1.50076 WP_000548702.1.5013 WP_000548702.1.50138 WP_000548702.1.50217 WP_000548702.1.50219 WP_000548702.1.50261 WP_000548702.1.50313 WP_000548702.1.50314 WP_000548702.1.50356 WP_000548702.1.50425 WP_000548702.1.50430 WP_000548702.1.50536 WP_000548702.1.50555 WP_000548702.1.50556 WP_000548702.1.50578 WP_000548702.1.50595 WP_000548702.1.50660 WP_000548702.1.50768 WP_000548702.1.50799 WP_000548702.1.50820 WP_000548702.1.50884 WP_000548702.1.50896 WP_000548702.1.50937 WP_000548702.1.50962 WP_000548702.1.5109 WP_000548702.1.5110 WP_000548702.1.5111 WP_000548702.1.51152 WP_000548702.1.51236 WP_000548702.1.51245 WP_000548702.1.51250 WP_000548702.1.51282 WP_000548702.1.51295 WP_000548702.1.51306 WP_000548702.1.51310 WP_000548702.1.51346 WP_000548702.1.51365 WP_000548702.1.51376 WP_000548702.1.51403 WP_000548702.1.51454 WP_000548702.1.51456 WP_000548702.1.51492 WP_000548702.1.515 WP_000548702.1.51527 WP_000548702.1.5155 WP_000548702.1.51559 WP_000548702.1.51575 WP_000548702.1.51590 WP_000548702.1.51665 WP_000548702.1.51716 WP_000548702.1.51748 WP_000548702.1.51797 WP_000548702.1.51836 WP_000548702.1.51842 WP_000548702.1.51844 WP_000548702.1.51871 WP_000548702.1.51883 WP_000548702.1.51924 WP_000548702.1.51936 WP_000548702.1.51952 WP_000548702.1.51971 WP_000548702.1.51995 WP_000548702.1.52078 WP_000548702.1.521 WP_000548702.1.5213 WP_000548702.1.52151 WP_000548702.1.52182 WP_000548702.1.52185 WP_000548702.1.52193 WP_000548702.1.52251 WP_000548702.1.52296 WP_000548702.1.523 WP_000548702.1.52322 WP_000548702.1.52331 WP_000548702.1.52340 WP_000548702.1.52442 WP_000548702.1.52463 WP_000548702.1.52518 WP_000548702.1.52548 WP_000548702.1.52595 WP_000548702.1.52623 WP_000548702.1.52624 WP_000548702.1.52645 WP_000548702.1.52687 WP_000548702.1.52699 WP_000548702.1.52715 WP_000548702.1.52722 WP_000548702.1.52848 WP_000548702.1.52877 WP_000548702.1.52878 WP_000548702.1.52941 WP_000548702.1.52947 WP_000548702.1.52984 WP_000548702.1.53002 WP_000548702.1.53071 WP_000548702.1.53140 WP_000548702.1.53153 WP_000548702.1.53178 WP_000548702.1.53209 WP_000548702.1.53260 WP_000548702.1.53317 WP_000548702.1.53319 WP_000548702.1.53387 WP_000548702.1.53394 WP_000548702.1.53403 WP_000548702.1.53432 WP_000548702.1.53462 WP_000548702.1.53521 WP_000548702.1.53577 WP_000548702.1.53641 WP_000548702.1.53648 WP_000548702.1.53766 WP_000548702.1.53827 WP_000548702.1.53835 WP_000548702.1.53889 WP_000548702.1.53915 WP_000548702.1.53934 WP_000548702.1.53969 WP_000548702.1.53999 WP_000548702.1.5401 WP_000548702.1.54022 WP_000548702.1.54094 WP_000548702.1.54109 WP_000548702.1.54147 WP_000548702.1.54229 WP_000548702.1.54253 WP_000548702.1.54297 WP_000548702.1.54395 WP_000548702.1.544 WP_000548702.1.54413 WP_000548702.1.54503 WP_000548702.1.54510 WP_000548702.1.54551 WP_000548702.1.54637 WP_000548702.1.54675 WP_000548702.1.5469 WP_000548702.1.54745 WP_000548702.1.54753 WP_000548702.1.54878 WP_000548702.1.54955 WP_000548702.1.55014 WP_000548702.1.5519 WP_000548702.1.55214 WP_000548702.1.55274 WP_000548702.1.55309 WP_000548702.1.55367 WP_000548702.1.55369 WP_000548702.1.55403 WP_000548702.1.55405 WP_000548702.1.55421 WP_000548702.1.55508 WP_000548702.1.5554 WP_000548702.1.55544 WP_000548702.1.55558 WP_000548702.1.5556 WP_000548702.1.55583 WP_000548702.1.5559 WP_000548702.1.55628 WP_000548702.1.55637 WP_000548702.1.55653 WP_000548702.1.557 WP_000548702.1.55728 WP_000548702.1.55786 WP_000548702.1.5580 WP_000548702.1.55818 WP_000548702.1.55831 WP_000548702.1.55835 WP_000548702.1.55867 WP_000548702.1.55886 WP_000548702.1.5589 WP_000548702.1.55904 WP_000548702.1.55916 WP_000548702.1.55933 WP_000548702.1.55949 WP_000548702.1.55953 WP_000548702.1.55985 WP_000548702.1.56000 WP_000548702.1.56025 WP_000548702.1.56048 WP_000548702.1.56078 WP_000548702.1.56098 WP_000548702.1.56225 WP_000548702.1.5623 WP_000548702.1.56239 WP_000548702.1.56281 WP_000548702.1.56332 WP_000548702.1.56333 WP_000548702.1.5635 WP_000548702.1.5644 WP_000548702.1.56558 WP_000548702.1.5658 WP_000548702.1.56598 WP_000548702.1.566 WP_000548702.1.56628 WP_000548702.1.56641 WP_000548702.1.56658 WP_000548702.1.5666 WP_000548702.1.5677 WP_000548702.1.56778 WP_000548702.1.56794 WP_000548702.1.56815 WP_000548702.1.56856 WP_000548702.1.5686 WP_000548702.1.56865 WP_000548702.1.56878 WP_000548702.1.569 WP_000548702.1.56986 WP_000548702.1.57047 WP_000548702.1.57073 WP_000548702.1.57075 WP_000548702.1.57097 WP_000548702.1.57109 WP_000548702.1.57170 WP_000548702.1.5718 WP_000548702.1.57190 WP_000548702.1.57214 WP_000548702.1.57265 WP_000548702.1.57309 WP_000548702.1.57338 WP_000548702.1.57445 WP_000548702.1.57481 WP_000548702.1.5749 WP_000548702.1.57594 WP_000548702.1.57650 WP_000548702.1.57665 WP_000548702.1.57682 WP_000548702.1.57692 WP_000548702.1.57730 WP_000548702.1.57734 WP_000548702.1.57754 WP_000548702.1.57808 WP_000548702.1.57819 WP_000548702.1.57837 WP_000548702.1.57840 WP_000548702.1.57861 WP_000548702.1.57878 WP_000548702.1.5791 WP_000548702.1.57943 WP_000548702.1.57952 WP_000548702.1.57974 WP_000548702.1.58016 WP_000548702.1.58049 WP_000548702.1.58074 WP_000548702.1.58116 WP_000548702.1.58127 WP_000548702.1.58148 WP_000548702.1.5816 WP_000548702.1.58277 WP_000548702.1.58317 WP_000548702.1.58352 WP_000548702.1.58364 WP_000548702.1.58395 WP_000548702.1.58430 WP_000548702.1.58435 WP_000548702.1.58512 WP_000548702.1.58530 WP_000548702.1.5857 WP_000548702.1.58571 WP_000548702.1.58592 WP_000548702.1.58598 WP_000548702.1.58686 WP_000548702.1.58704 WP_000548702.1.58735 WP_000548702.1.58760 WP_000548702.1.58763 WP_000548702.1.58772 WP_000548702.1.5880 WP_000548702.1.58833 WP_000548702.1.58934 WP_000548702.1.58981 WP_000548702.1.59011 WP_000548702.1.59014 WP_000548702.1.59039 WP_000548702.1.59077 WP_000548702.1.59098 WP_000548702.1.59124 WP_000548702.1.59146 WP_000548702.1.5920 WP_000548702.1.59311 WP_000548702.1.59329 WP_000548702.1.59337 WP_000548702.1.59398 WP_000548702.1.5940 WP_000548702.1.59404 WP_000548702.1.59462 WP_000548702.1.59464 WP_000548702.1.59498 WP_000548702.1.59540 WP_000548702.1.59546 WP_000548702.1.59598 WP_000548702.1.59668 WP_000548702.1.59669 WP_000548702.1.59671 WP_000548702.1.5972 WP_000548702.1.59787 WP_000548702.1.5982 WP_000548702.1.59822 WP_000548702.1.59874 WP_000548702.1.59907 WP_000548702.1.59915 WP_000548702.1.60006 WP_000548702.1.6006 WP_000548702.1.6011 WP_000548702.1.60123 WP_000548702.1.60147 WP_000548702.1.60149 WP_000548702.1.60157 WP_000548702.1.6017 WP_000548702.1.60227 WP_000548702.1.60302 WP_000548702.1.60345 WP_000548702.1.60353 WP_000548702.1.60360 WP_000548702.1.60492 WP_000548702.1.60547 WP_000548702.1.60585 WP_000548702.1.60595 WP_000548702.1.60636 WP_000548702.1.60641 WP_000548702.1.60734 WP_000548702.1.60750 WP_000548702.1.60751 WP_000548702.1.60758 WP_000548702.1.60759 WP_000548702.1.60765 WP_000548702.1.60778 WP_000548702.1.60813 WP_000548702.1.60820 WP_000548702.1.60845 WP_000548702.1.6085 WP_000548702.1.60869 WP_000548702.1.60888 WP_000548702.1.60912 WP_000548702.1.60923 WP_000548702.1.60948 WP_000548702.1.60965 WP_000548702.1.60991 WP_000548702.1.61013 WP_000548702.1.61023 WP_000548702.1.61026 WP_000548702.1.61029 WP_000548702.1.61031 WP_000548702.1.61082 WP_000548702.1.61115 WP_000548702.1.61139 WP_000548702.1.61189 WP_000548702.1.6119 WP_000548702.1.61224 WP_000548702.1.6123 WP_000548702.1.61263 WP_000548702.1.61271 WP_000548702.1.61286 WP_000548702.1.61289 WP_000548702.1.61313 WP_000548702.1.61316 WP_000548702.1.6136 WP_000548702.1.61375 WP_000548702.1.61430 WP_000548702.1.61439 WP_000548702.1.61440 WP_000548702.1.61555 WP_000548702.1.61585 WP_000548702.1.61597 WP_000548702.1.61615 WP_000548702.1.61639 WP_000548702.1.6166 WP_000548702.1.61705 WP_000548702.1.61749 WP_000548702.1.61800 WP_000548702.1.61802 WP_000548702.1.61838 WP_000548702.1.61903 WP_000548702.1.61936 WP_000548702.1.61978 WP_000548702.1.62002 WP_000548702.1.6201 WP_000548702.1.62028 WP_000548702.1.62069 WP_000548702.1.62071 WP_000548702.1.62096 WP_000548702.1.62247 WP_000548702.1.62254 WP_000548702.1.62346 WP_000548702.1.62352 WP_000548702.1.62382 WP_000548702.1.62398 WP_000548702.1.62429 WP_000548702.1.62437 WP_000548702.1.62453 WP_000548702.1.62474 WP_000548702.1.62496 WP_000548702.1.6250 WP_000548702.1.62553 WP_000548702.1.62602 WP_000548702.1.62653 WP_000548702.1.62671 WP_000548702.1.62674 WP_000548702.1.6268 WP_000548702.1.62723 WP_000548702.1.62764 WP_000548702.1.62771 WP_000548702.1.62822 WP_000548702.1.62824 WP_000548702.1.62831 WP_000548702.1.62863 WP_000548702.1.62880 WP_000548702.1.62970 WP_000548702.1.63003 WP_000548702.1.63027 WP_000548702.1.63052 WP_000548702.1.63070 WP_000548702.1.63083 WP_000548702.1.63139 WP_000548702.1.63140 WP_000548702.1.63220 WP_000548702.1.63266 WP_000548702.1.63289 WP_000548702.1.63304 WP_000548702.1.63313 WP_000548702.1.63333 WP_000548702.1.63341 WP_000548702.1.63441 WP_000548702.1.63469 WP_000548702.1.63471 WP_000548702.1.63589 WP_000548702.1.63673 WP_000548702.1.63678 WP_000548702.1.63726 WP_000548702.1.63729 WP_000548702.1.63751 WP_000548702.1.63759 WP_000548702.1.63774 WP_000548702.1.63828 WP_000548702.1.6388 WP_000548702.1.63907 WP_000548702.1.6403 WP_000548702.1.6408 WP_000548702.1.64192 WP_000548702.1.64250 WP_000548702.1.64304 WP_000548702.1.64367 WP_000548702.1.6438 WP_000548702.1.64400 WP_000548702.1.64456 WP_000548702.1.64457 WP_000548702.1.64525 WP_000548702.1.64583 WP_000548702.1.6459 WP_000548702.1.6462 WP_000548702.1.64630 WP_000548702.1.64677 WP_000548702.1.64686 WP_000548702.1.64720 WP_000548702.1.64765 WP_000548702.1.6479 WP_000548702.1.64858 WP_000548702.1.64879 WP_000548702.1.6488 WP_000548702.1.64893 WP_000548702.1.64897 WP_000548702.1.64928 WP_000548702.1.64935 WP_000548702.1.64961 WP_000548702.1.65044 WP_000548702.1.65132 WP_000548702.1.65158 WP_000548702.1.65180 WP_000548702.1.65193 WP_000548702.1.65217 WP_000548702.1.65243 WP_000548702.1.65317 WP_000548702.1.65367 WP_000548702.1.65419 WP_000548702.1.65423 WP_000548702.1.65432 WP_000548702.1.65443 WP_000548702.1.65451 WP_000548702.1.6547 WP_000548702.1.65504 WP_000548702.1.6551 WP_000548702.1.65520 WP_000548702.1.65544 WP_000548702.1.65562 WP_000548702.1.65675 WP_000548702.1.65689 WP_000548702.1.65693 WP_000548702.1.65700 WP_000548702.1.65703 WP_000548702.1.65705 WP_000548702.1.65856 WP_000548702.1.65922 WP_000548702.1.65931 WP_000548702.1.65948 WP_000548702.1.66009 WP_000548702.1.66081 WP_000548702.1.661 WP_000548702.1.66120 WP_000548702.1.66133 WP_000548702.1.66175 WP_000548702.1.66262 WP_000548702.1.66302 WP_000548702.1.66433 WP_000548702.1.66505 WP_000548702.1.66519 WP_000548702.1.66542 WP_000548702.1.66564 WP_000548702.1.66588 WP_000548702.1.66601 WP_000548702.1.66606 WP_000548702.1.66664 WP_000548702.1.66677 WP_000548702.1.66711 WP_000548702.1.6674 WP_000548702.1.66786 WP_000548702.1.66818 WP_000548702.1.6684 WP_000548702.1.67112 WP_000548702.1.67135 WP_000548702.1.67191 WP_000548702.1.6722 WP_000548702.1.67266 WP_000548702.1.67329 WP_000548702.1.67333 WP_000548702.1.67379 WP_000548702.1.6740 WP_000548702.1.67414 WP_000548702.1.67447 WP_000548702.1.67463 WP_000548702.1.67480 WP_000548702.1.67505 WP_000548702.1.67507 WP_000548702.1.67520 WP_000548702.1.67521 WP_000548702.1.67554 WP_000548702.1.67572 WP_000548702.1.67632 WP_000548702.1.67651 WP_000548702.1.67652 WP_000548702.1.67713 WP_000548702.1.67722 WP_000548702.1.67754 WP_000548702.1.67815 WP_000548702.1.6786 WP_000548702.1.67865 WP_000548702.1.67925 WP_000548702.1.67986 WP_000548702.1.68033 WP_000548702.1.68054 WP_000548702.1.68066 WP_000548702.1.6811 WP_000548702.1.68111 WP_000548702.1.68139 WP_000548702.1.68160 WP_000548702.1.68161 WP_000548702.1.68199 WP_000548702.1.68261 WP_000548702.1.68295 WP_000548702.1.6830 WP_000548702.1.68307 WP_000548702.1.6834 WP_000548702.1.68343 WP_000548702.1.68351 WP_000548702.1.68367 WP_000548702.1.6839 WP_000548702.1.68397 WP_000548702.1.68404 WP_000548702.1.68425 WP_000548702.1.68483 WP_000548702.1.68489 WP_000548702.1.68522 WP_000548702.1.68565 WP_000548702.1.68650 WP_000548702.1.68699 WP_000548702.1.68703 WP_000548702.1.68728 WP_000548702.1.68737 WP_000548702.1.68775 WP_000548702.1.68813 WP_000548702.1.68831 WP_000548702.1.68854 WP_000548702.1.68875 WP_000548702.1.68943 WP_000548702.1.68944 WP_000548702.1.69045 WP_000548702.1.69087 WP_000548702.1.69089 WP_000548702.1.6917 WP_000548702.1.69179 WP_000548702.1.69191 WP_000548702.1.69219 WP_000548702.1.69222 WP_000548702.1.69237 WP_000548702.1.69239 WP_000548702.1.69366 WP_000548702.1.69395 WP_000548702.1.69415 WP_000548702.1.69476 WP_000548702.1.69480 WP_000548702.1.695 WP_000548702.1.69552 WP_000548702.1.69563 WP_000548702.1.69622 WP_000548702.1.69679 WP_000548702.1.69877 WP_000548702.1.69878 WP_000548702.1.69921 WP_000548702.1.69987 WP_000548702.1.70024 WP_000548702.1.70048 WP_000548702.1.70105 WP_000548702.1.7012 WP_000548702.1.70133 WP_000548702.1.7024 WP_000548702.1.70253 WP_000548702.1.70273 WP_000548702.1.7034 WP_000548702.1.70344 WP_000548702.1.70349 WP_000548702.1.7043 WP_000548702.1.70451 WP_000548702.1.70459 WP_000548702.1.70462 WP_000548702.1.7053 WP_000548702.1.70546 WP_000548702.1.7061 WP_000548702.1.70635 WP_000548702.1.70641 WP_000548702.1.7067 WP_000548702.1.7073 WP_000548702.1.70818 WP_000548702.1.70823 WP_000548702.1.70829 WP_000548702.1.70855 WP_000548702.1.70924 WP_000548702.1.70930 WP_000548702.1.70943 WP_000548702.1.71043 WP_000548702.1.71058 WP_000548702.1.71059 WP_000548702.1.71073 WP_000548702.1.7109 WP_000548702.1.71130 WP_000548702.1.71182 WP_000548702.1.71196 WP_000548702.1.7120 WP_000548702.1.7125 WP_000548702.1.71257 WP_000548702.1.71295 WP_000548702.1.71298 WP_000548702.1.71325 WP_000548702.1.71345 WP_000548702.1.71359 WP_000548702.1.71416 WP_000548702.1.71463 WP_000548702.1.71466 WP_000548702.1.7150 WP_000548702.1.71519 WP_000548702.1.71529 WP_000548702.1.71543 WP_000548702.1.7158 WP_000548702.1.71596 WP_000548702.1.71602 WP_000548702.1.7161 WP_000548702.1.71662 WP_000548702.1.71676 WP_000548702.1.71735 WP_000548702.1.7179 WP_000548702.1.71861 WP_000548702.1.71925 WP_000548702.1.71989 WP_000548702.1.72026 WP_000548702.1.72031 WP_000548702.1.72067 WP_000548702.1.72169 WP_000548702.1.72205 WP_000548702.1.72271 WP_000548702.1.72330 WP_000548702.1.72347 WP_000548702.1.7236 WP_000548702.1.72366 WP_000548702.1.72424 WP_000548702.1.72478 WP_000548702.1.72547 WP_000548702.1.72654 WP_000548702.1.72787 WP_000548702.1.72816 WP_000548702.1.72832 WP_000548702.1.72834 WP_000548702.1.72835 WP_000548702.1.72903 WP_000548702.1.72904 WP_000548702.1.72935 WP_000548702.1.72945 WP_000548702.1.73017 WP_000548702.1.73019 WP_000548702.1.73022 WP_000548702.1.73037 WP_000548702.1.73122 WP_000548702.1.73132 WP_000548702.1.73246 WP_000548702.1.73265 WP_000548702.1.73286 WP_000548702.1.73386 WP_000548702.1.73444 WP_000548702.1.73456 WP_000548702.1.73501 WP_000548702.1.73571 WP_000548702.1.73591 WP_000548702.1.736 WP_000548702.1.73639 WP_000548702.1.73685 WP_000548702.1.73735 WP_000548702.1.73759 WP_000548702.1.73786 WP_000548702.1.7380 WP_000548702.1.73834 WP_000548702.1.73858 WP_000548702.1.73910 WP_000548702.1.73920 WP_000548702.1.73961 WP_000548702.1.73969 WP_000548702.1.73983 WP_000548702.1.74006 WP_000548702.1.74010 WP_000548702.1.74027 WP_000548702.1.74081 WP_000548702.1.74155 WP_000548702.1.74157 WP_000548702.1.74161 WP_000548702.1.74183 WP_000548702.1.74216 WP_000548702.1.74234 WP_000548702.1.74237 WP_000548702.1.7427 WP_000548702.1.7434 WP_000548702.1.74353 WP_000548702.1.74356 WP_000548702.1.74380 WP_000548702.1.74429 WP_000548702.1.74457 WP_000548702.1.7457 WP_000548702.1.74587 WP_000548702.1.74610 WP_000548702.1.74638 WP_000548702.1.74696 WP_000548702.1.74704 WP_000548702.1.74731 WP_000548702.1.74747 WP_000548702.1.74802 WP_000548702.1.74840 WP_000548702.1.74866 WP_000548702.1.74890 WP_000548702.1.74911 WP_000548702.1.74922 WP_000548702.1.74961 WP_000548702.1.74994 WP_000548702.1.74999 WP_000548702.1.75038 WP_000548702.1.75044 WP_000548702.1.75052 WP_000548702.1.75186 WP_000548702.1.75227 WP_000548702.1.75252 WP_000548702.1.75253 WP_000548702.1.75294 WP_000548702.1.75298 WP_000548702.1.75320 WP_000548702.1.75327 WP_000548702.1.75349 WP_000548702.1.75365 WP_000548702.1.75399 WP_000548702.1.7542 WP_000548702.1.75438 WP_000548702.1.75440 WP_000548702.1.75527 WP_000548702.1.75551 WP_000548702.1.7561 WP_000548702.1.75649 WP_000548702.1.75652 WP_000548702.1.75685 WP_000548702.1.75769 WP_000548702.1.75775 WP_000548702.1.758 WP_000548702.1.75830 WP_000548702.1.75881 WP_000548702.1.75885 WP_000548702.1.75929 WP_000548702.1.75952 WP_000548702.1.7596 WP_000548702.1.75969 WP_000548702.1.76010 WP_000548702.1.76015 WP_000548702.1.76095 WP_000548702.1.76143 WP_000548702.1.76230 WP_000548702.1.76234 WP_000548702.1.7624 WP_000548702.1.7625 WP_000548702.1.76258 WP_000548702.1.76261 WP_000548702.1.76332 WP_000548702.1.76337 WP_000548702.1.76351 WP_000548702.1.76419 WP_000548702.1.76420 WP_000548702.1.76421 WP_000548702.1.76606 WP_000548702.1.76624 WP_000548702.1.76648 WP_000548702.1.76686 WP_000548702.1.76690 WP_000548702.1.76693 WP_000548702.1.7675 WP_000548702.1.76790 WP_000548702.1.76792 WP_000548702.1.768 WP_000548702.1.76820 WP_000548702.1.76839 WP_000548702.1.76845 WP_000548702.1.76897 WP_000548702.1.76944 WP_000548702.1.76952 WP_000548702.1.76998 WP_000548702.1.77031 WP_000548702.1.77041 WP_000548702.1.77050 WP_000548702.1.77060 WP_000548702.1.77062 WP_000548702.1.77112 WP_000548702.1.77145 WP_000548702.1.77305 WP_000548702.1.7745 WP_000548702.1.7746 WP_000548702.1.77460 WP_000548702.1.77489 WP_000548702.1.77497 WP_000548702.1.77520 WP_000548702.1.77533 WP_000548702.1.77536 WP_000548702.1.77572 WP_000548702.1.77603 WP_000548702.1.77606 WP_000548702.1.77738 WP_000548702.1.7774 WP_000548702.1.77743 WP_000548702.1.77818 WP_000548702.1.77822 WP_000548702.1.77848 WP_000548702.1.77858 WP_000548702.1.7787 WP_000548702.1.78054 WP_000548702.1.78091 WP_000548702.1.78173 WP_000548702.1.78189 WP_000548702.1.78207 WP_000548702.1.78252 WP_000548702.1.78254 WP_000548702.1.78257 WP_000548702.1.7827 WP_000548702.1.78311 WP_000548702.1.7833 WP_000548702.1.78332 WP_000548702.1.78365 WP_000548702.1.78392 WP_000548702.1.78404 WP_000548702.1.7850 WP_000548702.1.78558 WP_000548702.1.7857 WP_000548702.1.78604 WP_000548702.1.78653 WP_000548702.1.78667 WP_000548702.1.7868 WP_000548702.1.78728 WP_000548702.1.78803 WP_000548702.1.78819 WP_000548702.1.78841 WP_000548702.1.78897 WP_000548702.1.78946 WP_000548702.1.78983 WP_000548702.1.7900 WP_000548702.1.79006 WP_000548702.1.79038 WP_000548702.1.79051 WP_000548702.1.79085 WP_000548702.1.79131 WP_000548702.1.79170 WP_000548702.1.79197 WP_000548702.1.79208 WP_000548702.1.79223 WP_000548702.1.79227 WP_000548702.1.7931 WP_000548702.1.79310 WP_000548702.1.79314 WP_000548702.1.79322 WP_000548702.1.79332 WP_000548702.1.79367 WP_000548702.1.79374 WP_000548702.1.79436 WP_000548702.1.79461 WP_000548702.1.79476 WP_000548702.1.79487 WP_000548702.1.79539 WP_000548702.1.79556 WP_000548702.1.79626 WP_000548702.1.79662 WP_000548702.1.79664 WP_000548702.1.79672 WP_000548702.1.79706 WP_000548702.1.79822 WP_000548702.1.79831 WP_000548702.1.79834 WP_000548702.1.79837 WP_000548702.1.7989 WP_000548702.1.79896 WP_000548702.1.79911 WP_000548702.1.7992 WP_000548702.1.79941 WP_000548702.1.79961 WP_000548702.1.79971 WP_000548702.1.79991 WP_000548702.1.80000 WP_000548702.1.80032 WP_000548702.1.80042 WP_000548702.1.80079 WP_000548702.1.80109 WP_000548702.1.80127 WP_000548702.1.80203 WP_000548702.1.80287 WP_000548702.1.80290 WP_000548702.1.8031 WP_000548702.1.8035 WP_000548702.1.80358 WP_000548702.1.80378 WP_000548702.1.8043 WP_000548702.1.80472 WP_000548702.1.80530 WP_000548702.1.8065 WP_000548702.1.80687 WP_000548702.1.80717 WP_000548702.1.80761 WP_000548702.1.80763 WP_000548702.1.80781 WP_000548702.1.80786 WP_000548702.1.80833 WP_000548702.1.8084 WP_000548702.1.80872 WP_000548702.1.80962 WP_000548702.1.81085 WP_000548702.1.81097 WP_000548702.1.81114 WP_000548702.1.81157 WP_000548702.1.81171 WP_000548702.1.81234 WP_000548702.1.8125 WP_000548702.1.81252 WP_000548702.1.8135 WP_000548702.1.81385 WP_000548702.1.81389 WP_000548702.1.8142 WP_000548702.1.8144 WP_000548702.1.81464 WP_000548702.1.81467 WP_000548702.1.81599 WP_000548702.1.81610 WP_000548702.1.81740 WP_000548702.1.81758 WP_000548702.1.81767 WP_000548702.1.81800 WP_000548702.1.81810 WP_000548702.1.81812 WP_000548702.1.81831 WP_000548702.1.81861 WP_000548702.1.81870 WP_000548702.1.81897 WP_000548702.1.81903 WP_000548702.1.81905 WP_000548702.1.81906 WP_000548702.1.81919 WP_000548702.1.81944 WP_000548702.1.81955 WP_000548702.1.81999 WP_000548702.1.82009 WP_000548702.1.82053 WP_000548702.1.8212 WP_000548702.1.82121 WP_000548702.1.82247 WP_000548702.1.82259 WP_000548702.1.82340 WP_000548702.1.82354 WP_000548702.1.82368 WP_000548702.1.82447 WP_000548702.1.8246 WP_000548702.1.82467 WP_000548702.1.82548 WP_000548702.1.82612 WP_000548702.1.8265 WP_000548702.1.82709 WP_000548702.1.82724 WP_000548702.1.82796 WP_000548702.1.8280 WP_000548702.1.82802 WP_000548702.1.82829 WP_000548702.1.82862 WP_000548702.1.8289 WP_000548702.1.82976 WP_000548702.1.82980 WP_000548702.1.83152 WP_000548702.1.83153 WP_000548702.1.83185 WP_000548702.1.83193 WP_000548702.1.83234 WP_000548702.1.83316 WP_000548702.1.83352 WP_000548702.1.83372 WP_000548702.1.83418 WP_000548702.1.83476 WP_000548702.1.83484 WP_000548702.1.83517 WP_000548702.1.83593 WP_000548702.1.83646 WP_000548702.1.83652 WP_000548702.1.83653 WP_000548702.1.83676 WP_000548702.1.83720 WP_000548702.1.83763 WP_000548702.1.83769 WP_000548702.1.83775 WP_000548702.1.83804 WP_000548702.1.8383 WP_000548702.1.83864 WP_000548702.1.83865 WP_000548702.1.83881 WP_000548702.1.83912 WP_000548702.1.83919 WP_000548702.1.83928 WP_000548702.1.83955 WP_000548702.1.83984 WP_000548702.1.84049 WP_000548702.1.84064 WP_000548702.1.84144 WP_000548702.1.84163 WP_000548702.1.84293 WP_000548702.1.84342 WP_000548702.1.84442 WP_000548702.1.84445 WP_000548702.1.84451 WP_000548702.1.84509 WP_000548702.1.84563 WP_000548702.1.84578 WP_000548702.1.84625 WP_000548702.1.84638 WP_000548702.1.8468 WP_000548702.1.84682 WP_000548702.1.8475 WP_000548702.1.84752 WP_000548702.1.84757 WP_000548702.1.84761 WP_000548702.1.84815 WP_000548702.1.84889 WP_000548702.1.84903 WP_000548702.1.84907 WP_000548702.1.84922 WP_000548702.1.8493 WP_000548702.1.84943 WP_000548702.1.85022 WP_000548702.1.85047 WP_000548702.1.85056 WP_000548702.1.85081 WP_000548702.1.85099 WP_000548702.1.85135 WP_000548702.1.85144 WP_000548702.1.85151 WP_000548702.1.85213 WP_000548702.1.85231 WP_000548702.1.85235 WP_000548702.1.85238 WP_000548702.1.85351 WP_000548702.1.85383 WP_000548702.1.85395 WP_000548702.1.85404 WP_000548702.1.85445 WP_000548702.1.85462 WP_000548702.1.85471 WP_000548702.1.85474 WP_000548702.1.85492 WP_000548702.1.85506 WP_000548702.1.85515 WP_000548702.1.85519 WP_000548702.1.85547 WP_000548702.1.85555 WP_000548702.1.85586 WP_000548702.1.85649 WP_000548702.1.85758 WP_000548702.1.85795 WP_000548702.1.85796 WP_000548702.1.85816 WP_000548702.1.85834 WP_000548702.1.85927 WP_000548702.1.85950 WP_000548702.1.85993 WP_000548702.1.86018 WP_000548702.1.86072 WP_000548702.1.86144 WP_000548702.1.86154 WP_000548702.1.86158 WP_000548702.1.86188 WP_000548702.1.86207 WP_000548702.1.8627 WP_000548702.1.86270 WP_000548702.1.86304 WP_000548702.1.86344 WP_000548702.1.86367 WP_000548702.1.86378 WP_000548702.1.8643 WP_000548702.1.86439 WP_000548702.1.86482 WP_000548702.1.86523 WP_000548702.1.86542 WP_000548702.1.86628 WP_000548702.1.86706 WP_000548702.1.86792 WP_000548702.1.8681 WP_000548702.1.86838 WP_000548702.1.86911 WP_000548702.1.86940 WP_000548702.1.86961 WP_000548702.1.86977 WP_000548702.1.87021 WP_000548702.1.87042 WP_000548702.1.87057 WP_000548702.1.87072 WP_000548702.1.87090 WP_000548702.1.87119 WP_000548702.1.87122 WP_000548702.1.87141 WP_000548702.1.87175 WP_000548702.1.87194 WP_000548702.1.8720 WP_000548702.1.87260 WP_000548702.1.87261 WP_000548702.1.87285 WP_000548702.1.87290 WP_000548702.1.8731 WP_000548702.1.87396 WP_000548702.1.87457 WP_000548702.1.87461 WP_000548702.1.87466 WP_000548702.1.87508 WP_000548702.1.87515 WP_000548702.1.8753 WP_000548702.1.87543 WP_000548702.1.87710 WP_000548702.1.87718 WP_000548702.1.87748 WP_000548702.1.87764 WP_000548702.1.87782 WP_000548702.1.87808 WP_000548702.1.87828 WP_000548702.1.87879 WP_000548702.1.87912 WP_000548702.1.87963 WP_000548702.1.87972 WP_000548702.1.87995 WP_000548702.1.88013 WP_000548702.1.88032 WP_000548702.1.88061 WP_000548702.1.88114 WP_000548702.1.88150 WP_000548702.1.88270 WP_000548702.1.88311 WP_000548702.1.88317 WP_000548702.1.88319 WP_000548702.1.88351 WP_000548702.1.88367 WP_000548702.1.88371 WP_000548702.1.88380 WP_000548702.1.88480 WP_000548702.1.88498 WP_000548702.1.88518 WP_000548702.1.88558 WP_000548702.1.8857 WP_000548702.1.88580 WP_000548702.1.88599 WP_000548702.1.88623 WP_000548702.1.88636 WP_000548702.1.88642 WP_000548702.1.88671 WP_000548702.1.88694 WP_000548702.1.88739 WP_000548702.1.88856 WP_000548702.1.88859 WP_000548702.1.8888 WP_000548702.1.88922 WP_000548702.1.88934 WP_000548702.1.8900 WP_000548702.1.89086 WP_000548702.1.8913 WP_000548702.1.89133 WP_000548702.1.89181 WP_000548702.1.89195 WP_000548702.1.89204 WP_000548702.1.8924 WP_000548702.1.89258 WP_000548702.1.89284 WP_000548702.1.89516 WP_000548702.1.89537 WP_000548702.1.89544 WP_000548702.1.89545 WP_000548702.1.89559 WP_000548702.1.89655 WP_000548702.1.89672 WP_000548702.1.89678 WP_000548702.1.89726 WP_000548702.1.89730 WP_000548702.1.89754 WP_000548702.1.8986 WP_000548702.1.89883 WP_000548702.1.89935 WP_000548702.1.89960 WP_000548702.1.90005 WP_000548702.1.90018 WP_000548702.1.90038 WP_000548702.1.90046 WP_000548702.1.90055 WP_000548702.1.90091 WP_000548702.1.90131 WP_000548702.1.90148 WP_000548702.1.90161 WP_000548702.1.90180 WP_000548702.1.90215 WP_000548702.1.9022 WP_000548702.1.90243 WP_000548702.1.90253 WP_000548702.1.90276 WP_000548702.1.9030 WP_000548702.1.90331 WP_000548702.1.90367 WP_000548702.1.90473 WP_000548702.1.90544 WP_000548702.1.90604 WP_000548702.1.90647 WP_000548702.1.90660 WP_000548702.1.90683 WP_000548702.1.90726 WP_000548702.1.90728 WP_000548702.1.90738 WP_000548702.1.90745 WP_000548702.1.90801 WP_000548702.1.90804 WP_000548702.1.90896 WP_000548702.1.90903 WP_000548702.1.9100 WP_000548702.1.91011 WP_000548702.1.91054 WP_000548702.1.91126 WP_000548702.1.9114 WP_000548702.1.91158 WP_000548702.1.91177 WP_000548702.1.912 WP_000548702.1.91233 WP_000548702.1.91246 WP_000548702.1.91258 WP_000548702.1.91279 WP_000548702.1.91300 WP_000548702.1.91332 WP_000548702.1.91346 WP_000548702.1.91357 WP_000548702.1.91364 WP_000548702.1.91382 WP_000548702.1.9140 WP_000548702.1.91420 WP_000548702.1.91427 WP_000548702.1.91487 WP_000548702.1.91559 WP_000548702.1.91573 WP_000548702.1.91581 WP_000548702.1.91587 WP_000548702.1.91639 WP_000548702.1.91749 WP_000548702.1.91771 WP_000548702.1.91791 WP_000548702.1.91800 WP_000548702.1.91816 WP_000548702.1.91829 WP_000548702.1.91895 WP_000548702.1.91928 WP_000548702.1.91950 WP_000548702.1.92 WP_000548702.1.92055 WP_000548702.1.92115 WP_000548702.1.92133 WP_000548702.1.92140 WP_000548702.1.92164 WP_000548702.1.92169 WP_000548702.1.92173 WP_000548702.1.92185 WP_000548702.1.92196 WP_000548702.1.92227 WP_000548702.1.9224 WP_000548702.1.92253 WP_000548702.1.9234 WP_000548702.1.9239 WP_000548702.1.92436 WP_000548702.1.92442 WP_000548702.1.92479 WP_000548702.1.92497 WP_000548702.1.92500 WP_000548702.1.92520 WP_000548702.1.92534 WP_000548702.1.92565 WP_000548702.1.92607 WP_000548702.1.92679 WP_000548702.1.92691 WP_000548702.1.92723 WP_000548702.1.92735 WP_000548702.1.92741 WP_000548702.1.92773 WP_000548702.1.92789 WP_000548702.1.92805 WP_000548702.1.92862 WP_000548702.1.92864 WP_000548702.1.9293 WP_000548702.1.92950 WP_000548702.1.9305 WP_000548702.1.93074 WP_000548702.1.93125 WP_000548702.1.93163 WP_000548702.1.93176 WP_000548702.1.93191 WP_000548702.1.93224 WP_000548702.1.93272 WP_000548702.1.93300 WP_000548702.1.93336 WP_000548702.1.93416 WP_000548702.1.93438 WP_000548702.1.93444 WP_000548702.1.93514 WP_000548702.1.9352 WP_000548702.1.9354 WP_000548702.1.9358 WP_000548702.1.93590 WP_000548702.1.93658 WP_000548702.1.93710 WP_000548702.1.93722 WP_000548702.1.93738 WP_000548702.1.93769 WP_000548702.1.93787 WP_000548702.1.9387 WP_000548702.1.93882 WP_000548702.1.93883 WP_000548702.1.93891 WP_000548702.1.93976 WP_000548702.1.9398 WP_000548702.1.93981 WP_000548702.1.94074 WP_000548702.1.94082 WP_000548702.1.94087 WP_000548702.1.94096 WP_000548702.1.94119 WP_000548702.1.94165 WP_000548702.1.94172 WP_000548702.1.94293 WP_000548702.1.94294 WP_000548702.1.94335 WP_000548702.1.94340 WP_000548702.1.9437 WP_000548702.1.94374 WP_000548702.1.94375 WP_000548702.1.94376 WP_000548702.1.94389 WP_000548702.1.94414 WP_000548702.1.94530 WP_000548702.1.94550 WP_000548702.1.9464 WP_000548702.1.94688 WP_000548702.1.94733 WP_000548702.1.94741 WP_000548702.1.94789 WP_000548702.1.94797 WP_000548702.1.94844 WP_000548702.1.94845 WP_000548702.1.9485 WP_000548702.1.94857 WP_000548702.1.94866 WP_000548702.1.9497 WP_000548702.1.94980 WP_000548702.1.94989 WP_000548702.1.94999 WP_000548702.1.95077 WP_000548702.1.9510 WP_000548702.1.95120 WP_000548702.1.95210 WP_000548702.1.95327 WP_000548702.1.95342 WP_000548702.1.95361 WP_000548702.1.95372 WP_000548702.1.9538 WP_000548702.1.9544 WP_000548702.1.95537 WP_000548702.1.95581 WP_000548702.1.95603 WP_000548702.1.95639 WP_000548702.1.95681 WP_000548702.1.95699 WP_000548702.1.95704 WP_000548702.1.95713 WP_000548702.1.95714 WP_000548702.1.95737 WP_000548702.1.95760 WP_000548702.1.95806 WP_000548702.1.95877 WP_000548702.1.95885 WP_000548702.1.95914 WP_000548702.1.95918 WP_000548702.1.95986 WP_000548702.1.95997 WP_000548702.1.96014 WP_000548702.1.96030 WP_000548702.1.96056 WP_000548702.1.96057 WP_000548702.1.96067 WP_000548702.1.96075 WP_000548702.1.96135 WP_000548702.1.96148 WP_000548702.1.96228 WP_000548702.1.96255 WP_000548702.1.96283 WP_000548702.1.96297 WP_000548702.1.96312 WP_000548702.1.96314 WP_000548702.1.96322 WP_000548702.1.96334 WP_000548702.1.96362 WP_000548702.1.96433 WP_000548702.1.96472 WP_000548702.1.9650 WP_000548702.1.96535 WP_000548702.1.96538 WP_000548702.1.96554 WP_000548702.1.96566 WP_000548702.1.96591 WP_000548702.1.96603 WP_000548702.1.96654 WP_000548702.1.96678 WP_000548702.1.96682 WP_000548702.1.96699 WP_000548702.1.96705 WP_000548702.1.9675 WP_000548702.1.96780 WP_000548702.1.96836 WP_000548702.1.96855 WP_000548702.1.96859 WP_000548702.1.96922 WP_000548702.1.96965 WP_000548702.1.96969 WP_000548702.1.96985 WP_000548702.1.96997 WP_000548702.1.97000 WP_000548702.1.97014 WP_000548702.1.97029 WP_000548702.1.97034 WP_000548702.1.97141 WP_000548702.1.97161 WP_000548702.1.97164 WP_000548702.1.97205 WP_000548702.1.97228 WP_000548702.1.97230 WP_000548702.1.97241 WP_000548702.1.97312 WP_000548702.1.97336 WP_000548702.1.97348 WP_000548702.1.97352 WP_000548702.1.97355 WP_000548702.1.97367 WP_000548702.1.9737 WP_000548702.1.97392 WP_000548702.1.97427 WP_000548702.1.97450 WP_000548702.1.97456 WP_000548702.1.97466 WP_000548702.1.97484 WP_000548702.1.97494 WP_000548702.1.97530 WP_000548702.1.97531 WP_000548702.1.97576 WP_000548702.1.97585 WP_000548702.1.97664 WP_000548702.1.97687 WP_000548702.1.97696 WP_000548702.1.97699 WP_000548702.1.97717 WP_000548702.1.97744 WP_000548702.1.97746 WP_000548702.1.97762 WP_000548702.1.9788 WP_000548702.1.97935 WP_000548702.1.97955 WP_000548702.1.97974 WP_000548702.1.97997 WP_000548702.1.98054 WP_000548702.1.98073 WP_000548702.1.98161 WP_000548702.1.98174 WP_000548702.1.98179 WP_000548702.1.98195 WP_000548702.1.98233 WP_000548702.1.98248 WP_000548702.1.98249 WP_000548702.1.98281 WP_000548702.1.98295 WP_000548702.1.98328 WP_000548702.1.98352 WP_000548702.1.98353 WP_000548702.1.98366 WP_000548702.1.98387 WP_000548702.1.98409 WP_000548702.1.98425 WP_000548702.1.98585 WP_000548702.1.98609 WP_000548702.1.98659 WP_000548702.1.98667 WP_000548702.1.9872 WP_000548702.1.98723 WP_000548702.1.98730 WP_000548702.1.98734 WP_000548702.1.98741 WP_000548702.1.98750 WP_000548702.1.98786 WP_000548702.1.98797 WP_000548702.1.98821 WP_000548702.1.98842 WP_000548702.1.98880 WP_000548702.1.98883 WP_000548702.1.98894 WP_000548702.1.98978 WP_000548702.1.98985 WP_000548702.1.9910 WP_000548702.1.99136 WP_000548702.1.99207 WP_000548702.1.99283 WP_000548702.1.99308 WP_000548702.1.99414 WP_000548702.1.99418 WP_000548702.1.99509 WP_000548702.1.99523 WP_000548702.1.9965 WP_000548702.1.99683 WP_000548702.1.99830 WP_000548702.1.99849 WP_000548702.1.99859 WP_000548702.1.99884 WP_000548702.1.99954 WP_000548702.1.99955 WP_000548702.1.99984 gi|150394847|ref|YP_001317522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]