SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360094.PXO_01653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360094.PXO_01653
Domain Number 1 Region: 85-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000523
Family NfeD domain-like 0.0074
Further Details:      
 
Weak hits

Sequence:  360094.PXO_01653
Domain Number - Region: 3-72
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0719
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360094.PXO_01653
Sequence length 144
Comment (Xanthomonas oryzae PXO99A)
Sequence
MRWDVAVWAVLALLLIAAETLVPGAFLLWMGIAAAVVCVLVLVLPDIALLVQIVAFVVLS
FVSVQVYRTWCRGKGRESDRPLLNRRAEQLIGRRVLLDQAIDDGRGRVKVDDAFWVVAGP
DLPAGTPVRIVGVDGMTLLVQPVS
Download sequence
Identical sequences A0A0K0GLR3 A0A0U4W2T5
gi|188577344|ref|YP_001914273.1| 360094.PXO_01653 WP_012445293.1.100287 WP_012445293.1.101918 WP_012445293.1.10801 WP_012445293.1.11746 WP_012445293.1.11992 WP_012445293.1.12016 WP_012445293.1.12038 WP_012445293.1.12532 WP_012445293.1.13943 WP_012445293.1.15093 WP_012445293.1.15664 WP_012445293.1.16001 WP_012445293.1.17939 WP_012445293.1.19029 WP_012445293.1.19407 WP_012445293.1.19779 WP_012445293.1.20356 WP_012445293.1.27990 WP_012445293.1.29999 WP_012445293.1.30088 WP_012445293.1.3010 WP_012445293.1.32656 WP_012445293.1.34187 WP_012445293.1.34656 WP_012445293.1.34831 WP_012445293.1.353 WP_012445293.1.35359 WP_012445293.1.38499 WP_012445293.1.40044 WP_012445293.1.40785 WP_012445293.1.42687 WP_012445293.1.42954 WP_012445293.1.43671 WP_012445293.1.44430 WP_012445293.1.45003 WP_012445293.1.4539 WP_012445293.1.46170 WP_012445293.1.47084 WP_012445293.1.47137 WP_012445293.1.48014 WP_012445293.1.48578 WP_012445293.1.49044 WP_012445293.1.49225 WP_012445293.1.50457 WP_012445293.1.50569 WP_012445293.1.51059 WP_012445293.1.52109 WP_012445293.1.53330 WP_012445293.1.537 WP_012445293.1.55471 WP_012445293.1.56638 WP_012445293.1.56661 WP_012445293.1.57225 WP_012445293.1.57350 WP_012445293.1.57935 WP_012445293.1.58736 WP_012445293.1.60363 WP_012445293.1.60953 WP_012445293.1.61025 WP_012445293.1.61774 WP_012445293.1.61876 WP_012445293.1.65775 WP_012445293.1.67359 WP_012445293.1.67821 WP_012445293.1.68588 WP_012445293.1.68727 WP_012445293.1.68760 WP_012445293.1.69729 WP_012445293.1.74787 WP_012445293.1.75518 WP_012445293.1.76491 WP_012445293.1.76573 WP_012445293.1.76801 WP_012445293.1.8070 WP_012445293.1.81518 WP_012445293.1.8269 WP_012445293.1.82912 WP_012445293.1.83077 WP_012445293.1.8313 WP_012445293.1.83277 WP_012445293.1.84104 WP_012445293.1.85262 WP_012445293.1.85266 WP_012445293.1.86486 WP_012445293.1.87020 WP_012445293.1.88561 WP_012445293.1.89095 WP_012445293.1.91866 WP_012445293.1.91997 WP_012445293.1.93038 WP_012445293.1.94099 WP_012445293.1.94601 WP_012445293.1.95101 WP_012445293.1.95975 WP_012445293.1.96729 WP_012445293.1.97155 WP_012445293.1.97395 WP_012445293.1.99258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]