SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360094.PXO_02186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360094.PXO_02186
Domain Number 1 Region: 17-129
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000327
Family Voltage-gated potassium channels 0.0047
Further Details:      
 
Domain Number 2 Region: 107-217
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000335
Family Potassium channel NAD-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360094.PXO_02186
Sequence length 346
Comment (Xanthomonas oryzae PXO99A)
Sequence
MRRVSWGMVTLALLAHMGLSWVLLLWAGEQKRVGLDAFAYYYMTTATTIGDGDLSPGSVA
GRSLVAFVLMSGAMALFTTMLAKTSGVRITVWRRHHMGKMAYADLRGHTILIGWQGAAST
RLLELLLSDTATDDEGVVLIAEGVAGNPLPDHMRFIAAESYTHTEVYLRAGITGAARVIV
NLPSDDQTLAAVFALMAHAPAAHIVAHFDSASAARLVNCHYPAIECARPMTAEILARAAQ
DPGSAAITAELLSVDDGPTQFSRAAPANAQPLDDSRLAADFNQRGTLLLGLRAPDGALRL
NPPARIAVAAGAMLSYLAEQRVPAHAIAWQAVRSEASPMSPSLQGV
Download sequence
Identical sequences A0A0K0GNV4
gi|188578151|ref|YP_001915080.1| 360094.PXO_02186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]