SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360094.PXO_03266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360094.PXO_03266
Domain Number 1 Region: 184-431
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.14e-71
Family D-glucarate dehydratase-like 0.000000000532
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.93e-38
Family Enolase N-terminal domain-like 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360094.PXO_03266
Sequence length 439
Comment (Xanthomonas oryzae PXO99A)
Sequence
MSTIVALDTHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDAADDLAGYGLVFTIGRGN
DVQTAAVAALAEHVLGLRVEDVIADLGAFARRLTNDSQLRWLGPEKGVMHMAIGAVINAA
WDLAARAANKPLWRFIAELTPEQLVDTIDLRYLSDALTRDEALAILRDAQPQREQRIAQL
IEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRTIKLKVGANVQDDIRRCRLAREAIG
PDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEEPTSPDDVLGHAAIRQGITPVPVSTG
EHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLLAAKFNVRVFPHAGGVGLCEL
VQHLAMADFVAITGQMEDRAIEFVDHLHQHFLDPVRIRHGRYLAPDVPGFSAEMHAASIA
EFSYPNGRFWVEDLAAAKA
Download sequence
Identical sequences A0A0K0GRE5 A0A2K1J5Z8
gi|84625929|ref|YP_453301.1| gi|188579152|ref|YP_001916081.1| WP_011409790.1.100287 WP_011409790.1.12284 WP_011409790.1.20356 WP_011409790.1.2575 WP_011409790.1.30088 WP_011409790.1.39578 WP_011409790.1.40785 WP_011409790.1.41276 WP_011409790.1.47084 WP_011409790.1.47137 WP_011409790.1.48014 WP_011409790.1.49377 WP_011409790.1.50457 WP_011409790.1.56997 WP_011409790.1.61025 WP_011409790.1.65775 WP_011409790.1.71791 WP_011409790.1.76573 WP_011409790.1.8070 WP_011409790.1.82912 WP_011409790.1.83277 WP_011409790.1.93038 WP_011409790.1.94099 WP_011409790.1.95975 WP_011409790.1.97395 342109.XOO_4272 360094.PXO_03266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]