SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 360095.BARBAKC583_0473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360095.BARBAKC583_0473
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily RNase III domain-like 5.58e-44
Family RNase III catalytic domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 113-229
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.93e-24
Family Double-stranded RNA-binding domain (dsRBD) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360095.BARBAKC583_0473
Sequence length 235
Comment (Bartonella bacilliformis KC583)
Sequence
MKHQTIDQLKKLTGHSFKNEDLLKKALTHSSVQRSEQGNYERLEFLGDRVLGLLVAEMLY
QFFPQASEGELSVRLNGLVNAQTCADIAREIGLPDMVHVGCEMKNLEGRRLANMHADVVE
ALIAVIYLDGGLKSVRPFIQRYWQDRAKKIDASRRDAKTELQEWAHTQNGVQPQYRVIKR
CGLDHDPVFVVEVSVPGFVSEVGEGGSKRHAERAAAEKILRREGMWGSIEKDDHG
Download sequence
Identical sequences A1US36
WP_005766546.1.100295 WP_005766546.1.16356 WP_005766546.1.26503 WP_005766546.1.64295 WP_005766546.1.80728 WP_005766546.1.81938 WP_005766546.1.90564 WP_005766546.1.94202 WP_005766546.1.95831 WP_005766546.1.963 WP_005766546.1.97869 360095.BARBAKC583_0473 gi|121602768|ref|YP_988789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]