SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360102.YPA_0863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360102.YPA_0863
Domain Number 1 Region: 183-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.49e-69
Family D-glucarate dehydratase-like 0.000000159
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.77e-37
Family Enolase N-terminal domain-like 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360102.YPA_0863
Sequence length 425
Comment (Yersinia pestis Antiqua)
Sequence
MTIITALRTEDVRFPTSLELDGSDAMNPDPDYSAAYVILDTDNPALSGHGLTFTIGRGNE
ICCVAIHALEHLIVGRDLASMTANMGKFWREFTSDSQLRWIGPEKGAIHLATGAVINAVW
DLWSKAEGKPLWRLVADMSPEELVRCIDFRYITDCITPEEALTLLQQRAHNKALRLEKLQ
DEGYPCYTTSAGWLGYPDDKLRRLCQDAVDAGFDYLKLKVGRDLEDDIRRVRITREVLGP
DRKLMIDANQIWETNEAIPWVNQLAFANPWFIEEPTNPDDIEGHRRIRQGVAPVKVATGE
MCQNRIMFKQFIMREAIDVVQIDACRLGGVNEVLAVMLMAAKYDLPVCPHAGGVGLCEYV
QHLAMIDYLCIAGTDKGRVIEYVDHLHEHFVHPCVIKNAAYMPPEQPGFSIEMHQSSIEK
YRFRV
Download sequence
Identical sequences A0A0E1NU41 A0A0H2YKJ5 A0A0H3B500 A0A0M1V350 A0A0U1EQV9 A0A0U1QYS0 A0A208RXR9 A0A2A7VGJ6 Q8CKY6
gi|294503541|ref|YP_003567603.1| gi|384126012|ref|YP_005508626.1| gi|153948929|ref|YP_001401379.1| gi|108806860|ref|YP_650776.1| gi|22126479|ref|NP_669902.1| gi|284987068|ref|YP_002346580.2| gi|186895004|ref|YP_001872116.1| gi|162418481|ref|YP_001606192.1| gi|108812573|ref|YP_648340.1| WP_002211917.1.100083 WP_002211917.1.100246 WP_002211917.1.100593 WP_002211917.1.10066 WP_002211917.1.100921 WP_002211917.1.100931 WP_002211917.1.10105 WP_002211917.1.101305 WP_002211917.1.101382 WP_002211917.1.101928 WP_002211917.1.102012 WP_002211917.1.102067 WP_002211917.1.10736 WP_002211917.1.10935 WP_002211917.1.10955 WP_002211917.1.11693 WP_002211917.1.12167 WP_002211917.1.12463 WP_002211917.1.12736 WP_002211917.1.12857 WP_002211917.1.1388 WP_002211917.1.14063 WP_002211917.1.14169 WP_002211917.1.14804 WP_002211917.1.15321 WP_002211917.1.15555 WP_002211917.1.15605 WP_002211917.1.15689 WP_002211917.1.16243 WP_002211917.1.16333 WP_002211917.1.17135 WP_002211917.1.17141 WP_002211917.1.17608 WP_002211917.1.17873 WP_002211917.1.17983 WP_002211917.1.18208 WP_002211917.1.18640 WP_002211917.1.18826 WP_002211917.1.19329 WP_002211917.1.19425 WP_002211917.1.19739 WP_002211917.1.20035 WP_002211917.1.20380 WP_002211917.1.20547 WP_002211917.1.2064 WP_002211917.1.20932 WP_002211917.1.21486 WP_002211917.1.21784 WP_002211917.1.21879 WP_002211917.1.21934 WP_002211917.1.22530 WP_002211917.1.22542 WP_002211917.1.22708 WP_002211917.1.23157 WP_002211917.1.23271 WP_002211917.1.23687 WP_002211917.1.23811 WP_002211917.1.24002 WP_002211917.1.2451 WP_002211917.1.24517 WP_002211917.1.25181 WP_002211917.1.25394 WP_002211917.1.26383 WP_002211917.1.2640 WP_002211917.1.26776 WP_002211917.1.26960 WP_002211917.1.27124 WP_002211917.1.27251 WP_002211917.1.2726 WP_002211917.1.28647 WP_002211917.1.28922 WP_002211917.1.29157 WP_002211917.1.29186 WP_002211917.1.29355 WP_002211917.1.2947 WP_002211917.1.29622 WP_002211917.1.2964 WP_002211917.1.29685 WP_002211917.1.29814 WP_002211917.1.3092 WP_002211917.1.30931 WP_002211917.1.311 WP_002211917.1.31336 WP_002211917.1.31496 WP_002211917.1.31721 WP_002211917.1.31739 WP_002211917.1.31805 WP_002211917.1.32343 WP_002211917.1.32388 WP_002211917.1.32446 WP_002211917.1.32736 WP_002211917.1.33203 WP_002211917.1.33324 WP_002211917.1.33661 WP_002211917.1.33775 WP_002211917.1.33937 WP_002211917.1.34031 WP_002211917.1.34138 WP_002211917.1.35389 WP_002211917.1.35538 WP_002211917.1.36088 WP_002211917.1.37174 WP_002211917.1.37494 WP_002211917.1.37863 WP_002211917.1.38147 WP_002211917.1.38235 WP_002211917.1.38532 WP_002211917.1.38743 WP_002211917.1.38824 WP_002211917.1.38993 WP_002211917.1.39066 WP_002211917.1.39346 WP_002211917.1.3976 WP_002211917.1.39858 WP_002211917.1.40071 WP_002211917.1.40134 WP_002211917.1.40534 WP_002211917.1.40853 WP_002211917.1.41196 WP_002211917.1.4210 WP_002211917.1.42361 WP_002211917.1.42490 WP_002211917.1.42976 WP_002211917.1.44408 WP_002211917.1.44598 WP_002211917.1.44603 WP_002211917.1.44832 WP_002211917.1.45198 WP_002211917.1.45214 WP_002211917.1.46262 WP_002211917.1.46545 WP_002211917.1.46686 WP_002211917.1.46697 WP_002211917.1.46731 WP_002211917.1.4678 WP_002211917.1.46891 WP_002211917.1.47387 WP_002211917.1.47440 WP_002211917.1.47769 WP_002211917.1.47881 WP_002211917.1.48166 WP_002211917.1.48722 WP_002211917.1.4889 WP_002211917.1.49315 WP_002211917.1.49906 WP_002211917.1.4997 WP_002211917.1.50010 WP_002211917.1.50093 WP_002211917.1.50106 WP_002211917.1.50185 WP_002211917.1.50984 WP_002211917.1.51284 WP_002211917.1.51293 WP_002211917.1.51588 WP_002211917.1.51772 WP_002211917.1.51934 WP_002211917.1.52158 WP_002211917.1.52473 WP_002211917.1.52569 WP_002211917.1.52734 WP_002211917.1.52792 WP_002211917.1.52819 WP_002211917.1.52969 WP_002211917.1.53147 WP_002211917.1.53300 WP_002211917.1.53838 WP_002211917.1.53848 WP_002211917.1.53883 WP_002211917.1.53953 WP_002211917.1.54568 WP_002211917.1.54951 WP_002211917.1.55194 WP_002211917.1.55695 WP_002211917.1.5592 WP_002211917.1.56031 WP_002211917.1.56953 WP_002211917.1.57585 WP_002211917.1.57657 WP_002211917.1.58067 WP_002211917.1.58543 WP_002211917.1.58794 WP_002211917.1.59102 WP_002211917.1.59431 WP_002211917.1.5957 WP_002211917.1.59635 WP_002211917.1.5968 WP_002211917.1.59687 WP_002211917.1.59789 WP_002211917.1.59885 WP_002211917.1.60437 WP_002211917.1.60707 WP_002211917.1.60896 WP_002211917.1.61689 WP_002211917.1.62232 WP_002211917.1.62342 WP_002211917.1.6270 WP_002211917.1.6333 WP_002211917.1.63387 WP_002211917.1.63641 WP_002211917.1.64142 WP_002211917.1.64474 WP_002211917.1.64780 WP_002211917.1.64786 WP_002211917.1.64910 WP_002211917.1.653 WP_002211917.1.65400 WP_002211917.1.65554 WP_002211917.1.6570 WP_002211917.1.65706 WP_002211917.1.65718 WP_002211917.1.6581 WP_002211917.1.66118 WP_002211917.1.66546 WP_002211917.1.66616 WP_002211917.1.67404 WP_002211917.1.6791 WP_002211917.1.68361 WP_002211917.1.68371 WP_002211917.1.68753 WP_002211917.1.68855 WP_002211917.1.69018 WP_002211917.1.69316 WP_002211917.1.69951 WP_002211917.1.70117 WP_002211917.1.70171 WP_002211917.1.70319 WP_002211917.1.70377 WP_002211917.1.70417 WP_002211917.1.70726 WP_002211917.1.7083 WP_002211917.1.7169 WP_002211917.1.71744 WP_002211917.1.72280 WP_002211917.1.72440 WP_002211917.1.72486 WP_002211917.1.7402 WP_002211917.1.74131 WP_002211917.1.74310 WP_002211917.1.74738 WP_002211917.1.75169 WP_002211917.1.75173 WP_002211917.1.7518 WP_002211917.1.75208 WP_002211917.1.75337 WP_002211917.1.75407 WP_002211917.1.75636 WP_002211917.1.75689 WP_002211917.1.75821 WP_002211917.1.76555 WP_002211917.1.77295 WP_002211917.1.77387 WP_002211917.1.77429 WP_002211917.1.77569 WP_002211917.1.77691 WP_002211917.1.78004 WP_002211917.1.7841 WP_002211917.1.78556 WP_002211917.1.79515 WP_002211917.1.79550 WP_002211917.1.79609 WP_002211917.1.79825 WP_002211917.1.79981 WP_002211917.1.8009 WP_002211917.1.80331 WP_002211917.1.81848 WP_002211917.1.81877 WP_002211917.1.8210 WP_002211917.1.82133 WP_002211917.1.82151 WP_002211917.1.82270 WP_002211917.1.82436 WP_002211917.1.82619 WP_002211917.1.8303 WP_002211917.1.83039 WP_002211917.1.83265 WP_002211917.1.83630 WP_002211917.1.8420 WP_002211917.1.84703 WP_002211917.1.84720 WP_002211917.1.85269 WP_002211917.1.85270 WP_002211917.1.8559 WP_002211917.1.85802 WP_002211917.1.86034 WP_002211917.1.86059 WP_002211917.1.86413 WP_002211917.1.87107 WP_002211917.1.8728 WP_002211917.1.87418 WP_002211917.1.8762 WP_002211917.1.87853 WP_002211917.1.87988 WP_002211917.1.88362 WP_002211917.1.88472 WP_002211917.1.89359 WP_002211917.1.89542 WP_002211917.1.8964 WP_002211917.1.90176 WP_002211917.1.9051 WP_002211917.1.90624 WP_002211917.1.91263 WP_002211917.1.91373 WP_002211917.1.91844 WP_002211917.1.92030 WP_002211917.1.92331 WP_002211917.1.92604 WP_002211917.1.927 WP_002211917.1.9311 WP_002211917.1.9320 WP_002211917.1.93623 WP_002211917.1.93928 WP_002211917.1.93933 WP_002211917.1.94052 WP_002211917.1.94201 WP_002211917.1.94545 WP_002211917.1.94683 WP_002211917.1.95746 WP_002211917.1.95981 WP_002211917.1.97245 WP_002211917.1.97448 WP_002211917.1.97791 WP_002211917.1.97864 WP_002211917.1.97872 WP_002211917.1.97894 WP_002211917.1.99109 WP_002211917.1.99383 WP_002211917.1.9941 WP_002211917.1.99416 WP_002211917.1.99788 WP_002211917.1.99882 WP_002211917.1.99990 YP_002346580.2.25044 gi|284987826|ref|YP_070105.2| 187410.y2598 229193.YP_1455 349746.YpAngola_A1697 349747.YpsIP31758_2410 360102.YPA_0863 377628.YPN_2412 386656.YPDSF_1408 502800.YPK_2508 502801.YPTS_1690 gi|384415058|ref|YP_005624420.1| gi|384140547|ref|YP_005523249.1| gi|45441278|ref|NP_992817.1| gi|145598694|ref|YP_001162770.1| gi|384121987|ref|YP_005504607.1| gi|170024733|ref|YP_001721238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]