SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360104.CCC13826_1526 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360104.CCC13826_1526
Domain Number 1 Region: 20-82
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000379
Family LacY-like proton/sugar symporter 0.069
Further Details:      
 
Weak hits

Sequence:  360104.CCC13826_1526
Domain Number - Region: 95-130
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0144
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360104.CCC13826_1526
Sequence length 130
Comment (Campylobacter concisus 13826)
Sequence
MISPFIMIAIGALLCVAELMLFSFYLLFFGVAFIIVGAINFGFGFEWSFQILAVLALAFI
LLALLKAPLKSKFMAKKESFNEEFLDEPGVGEIRENMVYFKGTLWKYDGALKNGEKVQVL
GTKGDKVILK
Download sequence
Identical sequences A7ZC96
360104.CCC13826_1526 gi|157165675|ref|YP_001466404.1| WP_012001380.1.99898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]