SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360104.CCC13826_2093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360104.CCC13826_2093
Domain Number 1 Region: 138-409
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.12e-120
Family Enolase 0.0000000713
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.3e-52
Family Enolase N-terminal domain-like 0.00000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360104.CCC13826_2093
Sequence length 416
Comment (Campylobacter concisus 13826)
Sequence
MVFIEDVEAHEVLDSRGNPTVRATVRLSDGTEASAIVPSGASTGKREALELRDKDDRYAG
KGVLKAVSNVNEKIAEAVIGLDAYNQKAVDAEMLELDGTHNYSNLGANAVLGVSMAVARA
AAKSLNIPLYRYLGGANASILPVPMFNIINGGAHANNSVDFQEFMIMPFGFSTFSEALRA
ATEIYHKLKSILNAAGHSTAVGDEGGFAPNLKDNEEPLKLISQAVKEAGYELGSQIKLAL
DVASSELYKDGKYELEGKKFSSAELISYYEKLCEKYPIFSIEDGLSEDDWSGWAELTKRL
GSKVQLVGDDLFVTNEKILREGIEKNIANAILIKPNQIGSVTQTMQTVRLAQRNGYRCIM
SHRSGESEDAFIADFAVALNTGEIKTGATSRSERNAKYNRLLEIELEAGEFLGDNI
Download sequence
Identical sequences A7ZFN1
360104.CCC13826_2093 gi|157164833|ref|YP_001467589.1| WP_012140455.1.99898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]