SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360106.CFF8240_0200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360106.CFF8240_0200
Domain Number 1 Region: 137-408
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.98e-120
Family Enolase 0.0000000944
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.4e-49
Family Enolase N-terminal domain-like 0.00000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360106.CFF8240_0200
Sequence length 416
Comment (Campylobacter fetus 82-40)
Sequence
MVIVKKISAIEVLDSRGNPTIKTKVELCDGSIGEAIVPSGASTGKREALELRDGGEAFGG
KGVLKAIKNVNSMIAEEICGKDAYNQKAIDDAMLALDGTDNYSRIGANAVLGVSMAVARA
AANSLNIPLYRYLGGANACTLPVPMFNIINGGAHANNSVDFQEFMIMPFGFSKFSNALRA
ATEVYQTLKKILNDLGHSTAVGDEGGFAPNLKDNEEPIKIIMEAIKKAGYKPGEQIKLAL
DVASSELYDGKTYQIEGKKLTSEELVDRYVKLCDKYPIFSIEDGLSEDDWDGWKILSEKL
GDKIQLVGDDLFVTNEKILKEGIEKGIANAILIKPNQIGSVSQTMQTVRLAQRNGYRCVM
SHRSGESEDSFIADFAVALNTGEIKTGATSRSERNAKYNRLLEIELETSEFLGDKI
Download sequence
Identical sequences A0RMH2 W0D8F7
WP_002848225.1.1289 WP_002848225.1.1469 WP_002848225.1.16919 WP_002848225.1.17016 WP_002848225.1.36062 WP_002848225.1.38168 WP_002848225.1.39057 WP_002848225.1.41035 WP_002848225.1.42882 WP_002848225.1.44411 WP_002848225.1.46075 WP_002848225.1.46714 WP_002848225.1.48558 WP_002848225.1.51765 WP_002848225.1.5603 WP_002848225.1.59303 WP_002848225.1.60351 WP_002848225.1.62614 WP_002848225.1.63275 WP_002848225.1.68475 WP_002848225.1.71429 WP_002848225.1.74407 WP_002848225.1.77394 WP_002848225.1.81562 gi|118474357|ref|YP_891405.1| 360106.CFF8240_0200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]