SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360107.CHAB381_1030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  360107.CHAB381_1030
Domain Number - Region: 93-132
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00157
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 360107.CHAB381_1030
Sequence length 133
Comment (Campylobacter hominis ATCC BAA-381)
Sequence
MSAVILLIIGVLLMILEVLFLDFTLFFFGLGFTAVAIISFFVKISWQVQILCAFVLALVL
LFTLKKPIKMYFRKSGEEFNQEFLNETGIGEINNKMIYYKGTFWKSDEISDMKDGDKVEV
LGVKNGKIIIKKN
Download sequence
Identical sequences A7I248
360107.CHAB381_1030 gi|154148669|ref|YP_001406589.1| WP_012108886.1.87930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]