SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360115.COXBURSA331_A1661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360115.COXBURSA331_A1661
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.37e-27
Family Clp protease, ClpP subunit 0.09
Further Details:      
 
Domain Number 2 Region: 391-456
Classification Level Classification E-value
Superfamily NfeD domain-like 2.48e-16
Family NfeD domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 360115.COXBURSA331_A1661
Sequence length 458
Comment (Coxiella burnetii RSA 331)
Sequence
MYCRKRIFIRCFYILMLTFGLLGIASHIIAQNNTRRLAILIDIKGGIGPATADFFHRSLK
QATEKKAQVIILQLDTPGGLVTAMRDIIKDILASPIPVIGYVAPSGAHAASAGTYILYAT
HIAAMAPGTNLGAATPIAIGTPGGSSPEKGNEKKEGAKKAPAQKTAAEKKAISDARAYIR
SLAQLRGRNVEWAESAVVEAESLSAEEAYKIKVINIIASNIPNLLEQANGMKISVRGETQ
TVNTANLEIEKVEPNWRTRFLSVITDSSVAYILLMIGFYGIFFEFINPGFIVPGVVGAIS
LLLALYAFQLLPINYAGLALILLGLAFIVAEAFMPSFGMLGIGGGVAFVIGSIMLMRTDA
IGFGIPMYLIIAIAIVTIAFFLLVLSIAFRSRGRPIVSGREAVIGKRGVVNVSDKRMWVR
IEGERWQCKSDVPLQDGDEVVVERLEGLFCVVKPVEKK
Download sequence
Identical sequences 360115.COXBURSA331_A1661 gi|161830099|ref|YP_001597323.1| WP_012220675.1.31144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]