SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360911.EAT1b_0539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  360911.EAT1b_0539
Domain Number - Region: 56-83
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0353
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 360911.EAT1b_0539
Sequence length 153
Comment (Exiguobacterium AT1b)
Sequence
MDNQTSKWQFGHGRRWRRKLTLFKRNRAVSCRNGRKGFSNRMDRFIVQKRAARHVHETGF
FLVITLTIVVWLLGAALFWYTDVERTTRRLSEEILAIRFESHLLLAKERCGDRPLTLHKP
TGTLTCRPIAPNRTEVNIVLTSGERHKEVIVYE
Download sequence
Identical sequences C4L3H3
gi|229916270|ref|YP_002884916.1| 360911.EAT1b_0539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]