SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 360911.EAT1b_2370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  360911.EAT1b_2370
Domain Number 1 Region: 138-348
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.88e-44
Family D-glucarate dehydratase-like 0.0000274
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.96e-19
Family Enolase N-terminal domain-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 360911.EAT1b_2370
Sequence length 356
Comment (Exiguobacterium AT1b)
Sequence
MIKRADLSIVPLTFKHPIVTAHAVLSVRRTLILRLETVDGVVGYGEGAAFETPWYTEETT
QSMIDTSKLILNLLKGMTVTTDVFPNLVSSIIGQRMAKAMWESALWEIEATRANKSLKSF
ISAGDSVSCGRTIGIGLLNQTMKSIETALADGFERIKLKASPNELLPALREIRAVFPDAP
LMIDLNGSASDQPMEWFEQLDTYRLLMIEQPYPSRQFTKSAALQAKLTTPICLDESITSY
DDVETMAQLGAGKIVNIKPARVGGLSEAFHIRKHGTPYWVGGMYESGIGRYHTLLFASLS
GASFPADMSGTSAYFEQDLLDIPLEVENGKLTLPDSVQPDWNVIERLREEVITLQT
Download sequence
Identical sequences C4L317
gi|229918090|ref|YP_002886736.1| 360911.EAT1b_2370 NYSGXRC-9725a WP_015880850.1.32866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]