SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362242.MUL_2910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362242.MUL_2910
Domain Number 1 Region: 14-133
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.53e-24
Family Sfri0576-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 362242.MUL_2910
Sequence length 137
Comment (Mycobacterium ulcerans Agy99)
Sequence
MTVRGRLSPRSLGALMIDFSLDTEHCILHVRPETALDKEDFVKLAEVVDPHIEATGDLAG
LILNAPSFPGRDSFGAMVNHFRFIRDHQKHVKKIAVVIDSHLGDVAEHLTSHFVSAEVRH
FPAGQVEQAQQWILGGS
Download sequence
Identical sequences A0PS65
gi|118618323|ref|YP_906655.1| 362242.MUL_2910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]