SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362242.MUL_3726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362242.MUL_3726
Domain Number 1 Region: 249-509
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-59
Family PFOR Pyr module 0.05
Further Details:      
 
Domain Number 2 Region: 31-242
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000000000458
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 524-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000000817
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362242.MUL_3726
Sequence length 653
Comment (Mycobacterium ulcerans Agy99)
Sequence
MDPNGSEAGPESHTAATHGGLDRQRLENVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLA
TQPNYPAEIRAPAGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKANIGDLPLGG
MVIANSDEFTKRNLTKVGYVTNPLESDELEEYVVHSVPMTTLTLGAVEAIGASKKDGQRA
KNMFALGLVSWMYGRPIQTSETFIREKFARKPEIAEANVLALKAGWNFGETTEAFGTTYE
VPPAKLPPGDYRQISGNTALAYGIVAAGQLADLPVVLGSYPITPASDILHELSKHKNFNV
TTFQAEDEIGGICAALGAAYGGALGVTSTSGPGISLKSEALGLGVMTELPLIVIGVQRGG
PSTGLPTKTEQADLLQALYGRNGESPLAVLAPRSPADCFETALEAVRIAVSYHTPVILLS
DGAIANGSEPWRIPNVADLAPIKHTFAKPDEPFQPYARDPETLARQFAVPGTPGLEHRIG
GLEAANGTGAISYEPTNHDLMVRLRQAKIEGISVPDLEVDDPTGDAELLIIGWGSSYGPI
GEACRRARRRGTKVAHAHLRYLNPFPANLGEVLRRYPQVVAPEMNLGQLALVLRGKYLVD
VQSVTKVKGVSFLADEVGRFIRAALAGRLGELEQDKMMVAKLSAATVEAGVGA
Download sequence
Identical sequences A0PU29
362242.MUL_3726 gi|118618987|ref|YP_907319.1| WP_011741453.1.20315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]