SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362663.ECP_2305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362663.ECP_2305
Domain Number 1 Region: 104-305
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-50
Family D-glucarate dehydratase-like 0.00000000635
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-30
Family Enolase N-terminal domain-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362663.ECP_2305
Sequence length 320
Comment (Escherichia coli 536)
Sequence
MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLREGEREGWGEISPLPGFSQETWEDAQ
SVLLAWVNNWLAGDCELPQMPSVAFGVSCALAELAETLPQAANYRAAPLCNGDPDDLILK
LADMPGEKVAKVKVGLYEAVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNP
DYRHRIAFLEEPCKTRDDSRAFARETDIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTG
SLEKVREQVKAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQV
RRWPGSPLPLVDVDALERLL
Download sequence
Identical sequences A0A0J2EED0 Q0TFI0
gi|110642470|ref|YP_670200.1| WP_001255594.1.101586 WP_001255594.1.11608 WP_001255594.1.12763 WP_001255594.1.12915 WP_001255594.1.1312 WP_001255594.1.14144 WP_001255594.1.14164 WP_001255594.1.15274 WP_001255594.1.17461 WP_001255594.1.18802 WP_001255594.1.18828 WP_001255594.1.18934 WP_001255594.1.18962 WP_001255594.1.19135 WP_001255594.1.1963 WP_001255594.1.19654 WP_001255594.1.20115 WP_001255594.1.20224 WP_001255594.1.20452 WP_001255594.1.20803 WP_001255594.1.21729 WP_001255594.1.21773 WP_001255594.1.21899 WP_001255594.1.22042 WP_001255594.1.2512 WP_001255594.1.26131 WP_001255594.1.26861 WP_001255594.1.27260 WP_001255594.1.2745 WP_001255594.1.28732 WP_001255594.1.28736 WP_001255594.1.28919 WP_001255594.1.30447 WP_001255594.1.30658 WP_001255594.1.31119 WP_001255594.1.31129 WP_001255594.1.31657 WP_001255594.1.32024 WP_001255594.1.35328 WP_001255594.1.37226 WP_001255594.1.37388 WP_001255594.1.39377 WP_001255594.1.39423 WP_001255594.1.39717 WP_001255594.1.4122 WP_001255594.1.41822 WP_001255594.1.42191 WP_001255594.1.43868 WP_001255594.1.46378 WP_001255594.1.47709 WP_001255594.1.49338 WP_001255594.1.50056 WP_001255594.1.50627 WP_001255594.1.51804 WP_001255594.1.52299 WP_001255594.1.55420 WP_001255594.1.55888 WP_001255594.1.58292 WP_001255594.1.61663 WP_001255594.1.6444 WP_001255594.1.64670 WP_001255594.1.6576 WP_001255594.1.65834 WP_001255594.1.66787 WP_001255594.1.67047 WP_001255594.1.67891 WP_001255594.1.68838 WP_001255594.1.69999 WP_001255594.1.71538 WP_001255594.1.72258 WP_001255594.1.72962 WP_001255594.1.73333 WP_001255594.1.73572 WP_001255594.1.75892 WP_001255594.1.76596 WP_001255594.1.77057 WP_001255594.1.77408 WP_001255594.1.78677 WP_001255594.1.78773 WP_001255594.1.79348 WP_001255594.1.79365 WP_001255594.1.7967 WP_001255594.1.80559 WP_001255594.1.84014 WP_001255594.1.84059 WP_001255594.1.87074 WP_001255594.1.87738 WP_001255594.1.89150 WP_001255594.1.89217 WP_001255594.1.89379 WP_001255594.1.9037 WP_001255594.1.92096 WP_001255594.1.934 WP_001255594.1.94619 WP_001255594.1.9649 WP_001255594.1.98484 WP_001255594.1.99306 362663.ECP_2305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]