SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 362663.ECP_2371 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  362663.ECP_2371
Domain Number - Region: 135-214
Classification Level Classification E-value
Superfamily Acid proteases 0.013
Family Pepsin-like 0.027
Further Details:      
 
Domain Number - Region: 46-97
Classification Level Classification E-value
Superfamily Cupredoxins 0.0201
Family Multidomain cupredoxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 362663.ECP_2371
Sequence length 253
Comment (Escherichia coli 536)
Sequence
MKKTNLLFRLLILMVFMLGSRAGMGQTFRNVYIYYATFGWNSQVELYLDVAEVSSVYYGT
YYQSNYVMTLGNLPNRTWTGTGSSPAPTITVKDGTTVNNSFCPGMEALEAKDSRWECLKL
PLDITVDGDVGGCPWLVSIRATSQVVVGSVDKDIYYGPNATVSVCPTVSVTPYDVSWDEN
YINKTKTLSLQSTGGVIEKTLSTYLMKDGKLCDGSQMNEEGAYCRWVAQMITFSSSGCDN
ANVTVAPKQASHH
Download sequence
Identical sequences 362663.ECP_2371 gi|110642536|ref|YP_670266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]