SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362663.ECP_2768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362663.ECP_2768
Domain Number 1 Region: 139-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.36e-80
Family D-glucarate dehydratase-like 0.0000000000685
Further Details:      
 
Domain Number 2 Region: 8-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.89e-30
Family Enolase N-terminal domain-like 0.000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362663.ECP_2768
Sequence length 446
Comment (Escherichia coli 536)
Sequence
MSSQFTTPVVTEMQVIPVAGHDSMLMNLSGAHAPFFTRNIVIIKDNSGHTGVGEIPGGEK
IRKTLEDAIPLVVGKTLGEYKNVLTLVRNTFADRDAGGRGLQTFDLRTTIHVVTGIEAAM
LDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRKATPLPYQSQPDDSCDWYRLRHE
EAMTPDAVVRLAEAAYEKYGFNDFKLKGGVLAGEEEAESIVALAQRFPQARITLDPNGAW
SLNEAIKIGTYLKGSLAYAEDPCGAEQGFSGREVMAEFRRATGLPTATNMIATDWRQMGH
TLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGLTWGSHSNNHFDISLAMFTHVAAAAPG
KITAIDTHWIWQEGNQRLTKEPLEIKGGLVQVPEKPGLGVEIDMDQVMKAHELYQKHGLG
ARDDAMGMQYLIPGWTFDNKRPCMVR
Download sequence
Identical sequences A0A0H3EMW7 A0A0V9RI68 S1PVE3
gi|110642928|ref|YP_670658.1| gi|386640267|ref|YP_006107065.1| 362663.ECP_2768 gi|222157473|ref|YP_002557612.1| gi|386635443|ref|YP_006155162.1| gi|386630523|ref|YP_006150243.1| WP_000098258.1.100052 WP_000098258.1.100306 WP_000098258.1.100685 WP_000098258.1.10138 WP_000098258.1.101586 WP_000098258.1.101693 WP_000098258.1.101984 WP_000098258.1.102076 WP_000098258.1.102106 WP_000098258.1.10786 WP_000098258.1.10869 WP_000098258.1.11285 WP_000098258.1.11411 WP_000098258.1.11519 WP_000098258.1.11575 WP_000098258.1.11608 WP_000098258.1.12050 WP_000098258.1.12268 WP_000098258.1.12295 WP_000098258.1.12709 WP_000098258.1.12763 WP_000098258.1.1278 WP_000098258.1.12826 WP_000098258.1.12915 WP_000098258.1.1314 WP_000098258.1.13181 WP_000098258.1.13272 WP_000098258.1.13778 WP_000098258.1.14144 WP_000098258.1.14164 WP_000098258.1.14245 WP_000098258.1.14371 WP_000098258.1.15274 WP_000098258.1.15290 WP_000098258.1.15304 WP_000098258.1.15624 WP_000098258.1.1622 WP_000098258.1.16705 WP_000098258.1.16798 WP_000098258.1.16799 WP_000098258.1.16927 WP_000098258.1.17325 WP_000098258.1.17461 WP_000098258.1.17849 WP_000098258.1.18420 WP_000098258.1.18802 WP_000098258.1.18828 WP_000098258.1.18908 WP_000098258.1.18934 WP_000098258.1.18962 WP_000098258.1.19036 WP_000098258.1.19135 WP_000098258.1.19171 WP_000098258.1.19761 WP_000098258.1.19972 WP_000098258.1.20115 WP_000098258.1.20224 WP_000098258.1.20452 WP_000098258.1.20803 WP_000098258.1.20933 WP_000098258.1.20962 WP_000098258.1.21614 WP_000098258.1.21652 WP_000098258.1.21729 WP_000098258.1.21773 WP_000098258.1.22042 WP_000098258.1.22088 WP_000098258.1.22293 WP_000098258.1.22508 WP_000098258.1.22667 WP_000098258.1.23021 WP_000098258.1.23282 WP_000098258.1.23386 WP_000098258.1.23700 WP_000098258.1.24004 WP_000098258.1.24177 WP_000098258.1.24797 WP_000098258.1.2512 WP_000098258.1.2540 WP_000098258.1.25612 WP_000098258.1.25680 WP_000098258.1.25750 WP_000098258.1.26175 WP_000098258.1.26284 WP_000098258.1.26398 WP_000098258.1.26574 WP_000098258.1.26579 WP_000098258.1.26837 WP_000098258.1.26861 WP_000098258.1.2700 WP_000098258.1.2745 WP_000098258.1.2779 WP_000098258.1.27871 WP_000098258.1.28027 WP_000098258.1.28345 WP_000098258.1.28568 WP_000098258.1.28723 WP_000098258.1.28732 WP_000098258.1.28736 WP_000098258.1.28924 WP_000098258.1.29258 WP_000098258.1.2963 WP_000098258.1.29647 WP_000098258.1.29819 WP_000098258.1.29855 WP_000098258.1.29979 WP_000098258.1.30232 WP_000098258.1.30400 WP_000098258.1.30447 WP_000098258.1.30524 WP_000098258.1.30658 WP_000098258.1.30887 WP_000098258.1.309 WP_000098258.1.31119 WP_000098258.1.31129 WP_000098258.1.31657 WP_000098258.1.31675 WP_000098258.1.32024 WP_000098258.1.32478 WP_000098258.1.32650 WP_000098258.1.32748 WP_000098258.1.33352 WP_000098258.1.34117 WP_000098258.1.34208 WP_000098258.1.34294 WP_000098258.1.34362 WP_000098258.1.3469 WP_000098258.1.35107 WP_000098258.1.35127 WP_000098258.1.35328 WP_000098258.1.35394 WP_000098258.1.35578 WP_000098258.1.35741 WP_000098258.1.35889 WP_000098258.1.3600 WP_000098258.1.36459 WP_000098258.1.37032 WP_000098258.1.37312 WP_000098258.1.37388 WP_000098258.1.37477 WP_000098258.1.3912 WP_000098258.1.39209 WP_000098258.1.39313 WP_000098258.1.39377 WP_000098258.1.39423 WP_000098258.1.39651 WP_000098258.1.39709 WP_000098258.1.39717 WP_000098258.1.39734 WP_000098258.1.40019 WP_000098258.1.40349 WP_000098258.1.40486 WP_000098258.1.40843 WP_000098258.1.41063 WP_000098258.1.41078 WP_000098258.1.4122 WP_000098258.1.42191 WP_000098258.1.42228 WP_000098258.1.42600 WP_000098258.1.42903 WP_000098258.1.43427 WP_000098258.1.43868 WP_000098258.1.44051 WP_000098258.1.44327 WP_000098258.1.4459 WP_000098258.1.44717 WP_000098258.1.44836 WP_000098258.1.44855 WP_000098258.1.44977 WP_000098258.1.45190 WP_000098258.1.4530 WP_000098258.1.4576 WP_000098258.1.45793 WP_000098258.1.45801 WP_000098258.1.45891 WP_000098258.1.46217 WP_000098258.1.46378 WP_000098258.1.46438 WP_000098258.1.46487 WP_000098258.1.47124 WP_000098258.1.47189 WP_000098258.1.47235 WP_000098258.1.47366 WP_000098258.1.47454 WP_000098258.1.47498 WP_000098258.1.47709 WP_000098258.1.48626 WP_000098258.1.48902 WP_000098258.1.49170 WP_000098258.1.49179 WP_000098258.1.49338 WP_000098258.1.49483 WP_000098258.1.50056 WP_000098258.1.50228 WP_000098258.1.50627 WP_000098258.1.50700 WP_000098258.1.511 WP_000098258.1.51426 WP_000098258.1.5153 WP_000098258.1.51804 WP_000098258.1.52085 WP_000098258.1.52258 WP_000098258.1.52271 WP_000098258.1.52299 WP_000098258.1.53021 WP_000098258.1.54208 WP_000098258.1.54313 WP_000098258.1.5434 WP_000098258.1.54534 WP_000098258.1.54590 WP_000098258.1.54754 WP_000098258.1.5478 WP_000098258.1.55420 WP_000098258.1.5546 WP_000098258.1.55731 WP_000098258.1.55790 WP_000098258.1.55808 WP_000098258.1.55888 WP_000098258.1.55896 WP_000098258.1.55990 WP_000098258.1.56122 WP_000098258.1.56662 WP_000098258.1.56941 WP_000098258.1.57045 WP_000098258.1.57159 WP_000098258.1.5742 WP_000098258.1.57608 WP_000098258.1.57832 WP_000098258.1.58097 WP_000098258.1.58233 WP_000098258.1.58292 WP_000098258.1.58345 WP_000098258.1.585 WP_000098258.1.58737 WP_000098258.1.59060 WP_000098258.1.59292 WP_000098258.1.59483 WP_000098258.1.59815 WP_000098258.1.59970 WP_000098258.1.60096 WP_000098258.1.60544 WP_000098258.1.60555 WP_000098258.1.6138 WP_000098258.1.615 WP_000098258.1.62091 WP_000098258.1.62262 WP_000098258.1.62586 WP_000098258.1.63305 WP_000098258.1.63310 WP_000098258.1.63419 WP_000098258.1.63433 WP_000098258.1.63465 WP_000098258.1.64180 WP_000098258.1.643 WP_000098258.1.6444 WP_000098258.1.64712 WP_000098258.1.6500 WP_000098258.1.65456 WP_000098258.1.65565 WP_000098258.1.6576 WP_000098258.1.65834 WP_000098258.1.66421 WP_000098258.1.66511 WP_000098258.1.6666 WP_000098258.1.66706 WP_000098258.1.66727 WP_000098258.1.66787 WP_000098258.1.67029 WP_000098258.1.67047 WP_000098258.1.67132 WP_000098258.1.67164 WP_000098258.1.67590 WP_000098258.1.67669 WP_000098258.1.67760 WP_000098258.1.67891 WP_000098258.1.68052 WP_000098258.1.68279 WP_000098258.1.68793 WP_000098258.1.68838 WP_000098258.1.69158 WP_000098258.1.69382 WP_000098258.1.69450 WP_000098258.1.697 WP_000098258.1.69832 WP_000098258.1.69963 WP_000098258.1.69999 WP_000098258.1.701 WP_000098258.1.7015 WP_000098258.1.70230 WP_000098258.1.71287 WP_000098258.1.71405 WP_000098258.1.71538 WP_000098258.1.71967 WP_000098258.1.72117 WP_000098258.1.72258 WP_000098258.1.72298 WP_000098258.1.723 WP_000098258.1.72425 WP_000098258.1.72507 WP_000098258.1.72599 WP_000098258.1.72962 WP_000098258.1.73333 WP_000098258.1.73572 WP_000098258.1.74032 WP_000098258.1.74041 WP_000098258.1.74185 WP_000098258.1.74267 WP_000098258.1.74358 WP_000098258.1.74611 WP_000098258.1.74682 WP_000098258.1.74915 WP_000098258.1.75118 WP_000098258.1.75892 WP_000098258.1.76268 WP_000098258.1.76269 WP_000098258.1.76469 WP_000098258.1.76504 WP_000098258.1.76596 WP_000098258.1.76660 WP_000098258.1.76759 WP_000098258.1.76863 WP_000098258.1.76961 WP_000098258.1.77036 WP_000098258.1.77057 WP_000098258.1.77408 WP_000098258.1.77432 WP_000098258.1.77455 WP_000098258.1.77643 WP_000098258.1.77816 WP_000098258.1.78232 WP_000098258.1.78376 WP_000098258.1.78512 WP_000098258.1.78572 WP_000098258.1.78622 WP_000098258.1.78677 WP_000098258.1.78689 WP_000098258.1.78773 WP_000098258.1.78955 WP_000098258.1.78956 WP_000098258.1.79001 WP_000098258.1.79100 WP_000098258.1.79365 WP_000098258.1.79368 WP_000098258.1.7967 WP_000098258.1.80063 WP_000098258.1.80559 WP_000098258.1.80660 WP_000098258.1.80948 WP_000098258.1.81266 WP_000098258.1.81323 WP_000098258.1.81761 WP_000098258.1.82104 WP_000098258.1.82221 WP_000098258.1.83644 WP_000098258.1.8386 WP_000098258.1.83911 WP_000098258.1.84014 WP_000098258.1.84021 WP_000098258.1.8405 WP_000098258.1.84059 WP_000098258.1.84476 WP_000098258.1.84486 WP_000098258.1.85025 WP_000098258.1.85125 WP_000098258.1.85252 WP_000098258.1.85315 WP_000098258.1.85384 WP_000098258.1.85578 WP_000098258.1.85593 WP_000098258.1.86261 WP_000098258.1.86273 WP_000098258.1.86353 WP_000098258.1.8656 WP_000098258.1.86560 WP_000098258.1.86613 WP_000098258.1.87067 WP_000098258.1.87074 WP_000098258.1.87696 WP_000098258.1.87738 WP_000098258.1.87766 WP_000098258.1.88082 WP_000098258.1.88686 WP_000098258.1.88767 WP_000098258.1.88793 WP_000098258.1.88941 WP_000098258.1.89043 WP_000098258.1.89150 WP_000098258.1.89217 WP_000098258.1.89285 WP_000098258.1.89379 WP_000098258.1.89396 WP_000098258.1.89469 WP_000098258.1.902 WP_000098258.1.90357 WP_000098258.1.9037 WP_000098258.1.90775 WP_000098258.1.90842 WP_000098258.1.90844 WP_000098258.1.9087 WP_000098258.1.90905 WP_000098258.1.90960 WP_000098258.1.90996 WP_000098258.1.91220 WP_000098258.1.91566 WP_000098258.1.91666 WP_000098258.1.91756 WP_000098258.1.91893 WP_000098258.1.91954 WP_000098258.1.92025 WP_000098258.1.9209 WP_000098258.1.92767 WP_000098258.1.93139 WP_000098258.1.93233 WP_000098258.1.934 WP_000098258.1.93431 WP_000098258.1.93453 WP_000098258.1.93461 WP_000098258.1.93765 WP_000098258.1.93870 WP_000098258.1.93952 WP_000098258.1.94040 WP_000098258.1.94438 WP_000098258.1.94619 WP_000098258.1.9474 WP_000098258.1.94869 WP_000098258.1.95084 WP_000098258.1.95398 WP_000098258.1.95628 WP_000098258.1.95784 WP_000098258.1.96263 WP_000098258.1.96392 WP_000098258.1.9649 WP_000098258.1.96558 WP_000098258.1.96759 WP_000098258.1.96762 WP_000098258.1.9682 WP_000098258.1.97292 WP_000098258.1.98251 WP_000098258.1.98484 WP_000098258.1.99060 WP_000098258.1.99306 WP_000098258.1.99458 WP_000098258.1.99472 WP_000098258.1.99571 WP_000098258.1.99771 WP_000098258.1.99782 WP_000098258.1.99891 YP_006121075.1.29421 gi|387618053|ref|YP_006121075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]