SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362976.HQ1536A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362976.HQ1536A
Domain Number 1 Region: 197-463
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.36e-64
Family PFOR Pyr module 0.08
Further Details:      
 
Domain Number 2 Region: 5-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0039
Further Details:      
 
Domain Number 3 Region: 474-581
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000257
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362976.HQ1536A
Sequence length 598
Comment (Haloquadratum walsbyi)
Sequence
MPADFNWAIGGEAGDGIDSTGKIFAQALSRAGRHVFTSKDFASRIRGGYTAYKVRTAVDP
VQSVVDRLDVLIALTPRTIKENHDELHEGSVIIYDGERTTMENVEIPDGMVGLDVPLKRL
AEEAGGAIMRNVVALGAACAVADFPIENLDSALEKRFGSKGQSLVENNKEAARSGRDYVG
SEYHNEFDYSLETTDADYVLLNGDEAIGMGAIAAGCKFYAGYPITPATNVMEYLTGRIEQ
FGGHVLQAEDELSAINIALGAARAGARAMTATSGPGIDLMTETFGLIGTSETPLVIADVM
RSGPSTGMPTKQEQGDLNMLLYGGHGEIPRFVVAPTTIAECFWKTVEAFNLAEKYQTPVY
LAADLAMAVTERTFSPETFDMDDVEIERGKVVDESTIDQWQNEKSQFQPHALTDDGISPR
AFPGTTGGAHMSTGLEHDELGRRTEDTDMRVEQVDKRTRKVETARREEDLTPRSFGSEDA
PNLVISWGSNEGAMVEAMSILDERGIDVHFLSVPYLFPRYNLTEAIDEAETVIAVECNAT
GQFANVIEHDALSRVNRVNKYDGVRFKADELASKIEQTIDTASSAGTNEETETTEITQ
Download sequence
Identical sequences G0LGM6 Q18JZ0
WP_011570816.1.31310 WP_011570816.1.96088 gi|110667495|ref|YP_657306.1| 362976.HQ1536A gi|385802934|ref|YP_005839334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]