SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362976.HQ1575A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  362976.HQ1575A
Domain Number - Region: 94-155
Classification Level Classification E-value
Superfamily NfeD domain-like 0.034
Family NfeD domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 362976.HQ1575A
Sequence length 235
Comment (Haloquadratum walsbyi)
Sequence
MVTQAISVVAQLSLPAETLSLLLITAGLGLSILEAFAPGAHFVVLGVSLLATGLVGLLLG
TASPLVLSGLVVLFGSAALLGYREFDIYGTTGSEQTSDSNSLTGTYGRVTERVTPTQGQV
KLDAGGFDPYYSARSVDDELTAGTEVVVVDPGGGNVLTVEPLVGGVDEIDRALATEQANR
ETTNSENEDPTPTPTPNSNMTQTDDTQSDEQRDSESESGLESESEREREREPDLS
Download sequence
Identical sequences Q18JV1
WP_011570855.1.31310 gi|110667534|ref|YP_657345.1| 362976.HQ1575A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]