SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 365044.Pnap_0990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  365044.Pnap_0990
Domain Number 1 Region: 20-208
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.42e-22
Family Crotonase-like 0.076
Further Details:      
 
Domain Number 2 Region: 380-447
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000085
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 365044.Pnap_0990
Sequence length 453
Comment (Polaromonas naphthalenivorans CJ2)
Sequence
MRILALLLIFWSSLPGAQPVPAAVAPVVLLSQSGALGPAHADYLRRGLDKAAALKAQLVV
IQMDTPGGLDLSMRTVIKDILASPVPVASFVAPNGARAASAGTYILYASHVAAMAPATNL
GAATPVSLGPQPAAPREPAASRDKSGTDNAPSSAQAMLNKQTNDAAAYIRGLAELRGRNA
EWADKAVREAVSLSAQEALKLNVIDVVAADVPQLLKQLDGRKLSVLGQERRLATAAAEII
DIQPDWRTRLLAVITDPGIAYILLMIGFYGLLFEFYSPGLVAPGVIGGISLLLALFALQL
LPVSYTGLALIALGVGLLVAEHFAPGFGLLGLGGIVAFVIGSVMLIDTDAPAYRIPWPLI
AGVTLASAGFLLVVLNFALRARQRPVVSGREQLLGATGEVIVNPDGSLSASFLGEVWKVR
ANAPLGRGQQVRVVGIDGLVLSVEPVRPQGEAT
Download sequence
Identical sequences A1VKX9
365044.Pnap_0990 gi|121603899|ref|YP_981228.1| WP_011800401.1.22642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]