SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 365044.Pnap_1267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  365044.Pnap_1267
Domain Number 1 Region: 36-248
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-47
Family Voltage-gated potassium channels 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 365044.Pnap_1267
Sequence length 305
Comment (Polaromonas naphthalenivorans CJ2)
Sequence
MAPPDSNPPSSVPEKPLEGWRLRWYTVIFEADTRAGRLFDQALIGVILLSIAVVMADSVE
SVHRLHGRAFAVFEWIFTLLFTFEYIARLLSVRKPWRYATSFFGIIDLIALLPTYLALFV
PELHALIDVRVLRLLRVFRIFKLTAYVAEYQSLGQALAASRRKIMVFLSAVLMMVLVMGT
VMYVVEGRGNGFTSIPTSVYWAISTVTTVGFGDITPKTDLGRLVSSFMMLLGWGILAVPT
GIVSAEMAAQRRMQLTQATTTRTCHECLTEGHAPDATYCLHCGARLPVYQQHELAPDAPA
PGRAS
Download sequence
Identical sequences A1VLQ4
365044.Pnap_1267 gi|121604174|ref|YP_981503.1| WP_011800673.1.22642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]