SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00008281 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00008281
Domain Number 1 Region: 184-431
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.32e-62
Family D-glucarate dehydratase-like 0.000000213
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.54e-40
Family Enolase N-terminal domain-like 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00008281
Sequence length 451
Comment (Neosartorya fischeri)
Sequence
MVKITGFSTRDVRFPTSLDKTGSDAMNAAGDYSAAYCIINTDSSYAGHGMTFTIGRGNEI
VCAAISLLAPLVVGKDLDELTADWGKTWRYLVSDSQLRWIGPEKGVIHLALGAVVNALWD
LWAKTLNKPVWRIVADMTPEEFVRCIDFRYITDAITPEEAIALLKEVEPTKQERIKEAEE
SRAVPAYTTSAGWLGYTEDKLRALLKESVAQGYKHFKLKVGANVEEDRRRLAIAREAIGY
DRGNILMVDANQVWSVPEAIEWMHQLAEFKPWFIEEPTSPDDILGHAAIKKALENTPHGT
IGVATGEMCQNRVVFKQLLQAGALTVLQADACRVGGVNEVLAILLLARKFGVPIVPHSGG
VGLPEYTQHLSTIDYVVVSGKKSVLEYVDHLHEHFVHPSSVKDGYYVTPMEPGYSVEMKP
ESMDAFAFPGEEGKSWWRTEAAKTILEGPRI
Download sequence
Identical sequences A1DGR6
XP_001260470.1.95823 36630.CADNFIAP00008281 NFIA_085260||mandelate

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]