SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_0233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_0233
Domain Number 1 Region: 10-86
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000151
Family Anti-sigma factor antagonist SpoIIaa 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_0233
Sequence length 97
Comment (Sinorhizobium medicae WSM419)
Sequence
MASRNTAGKTLKLAPVLDLNEATVLHERLLALKGGAVTIDASGVERVGALCVQVLMAAAK
SWEEDRLSFTFAEASDAFVKTTQLIGAEIGPLMAKEI
Download sequence
Identical sequences A6U612
WP_011974443.1.29075 WP_011974443.1.31871 WP_011974443.1.61285 WP_011974443.1.7720 WP_011974443.1.89664 YP_001325927.1.44884 gi|150395460|ref|YP_001325927.1| 366394.Smed_0233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]