SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_0738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_0738
Domain Number 1 Region: 57-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 2.09e-25
Family Ribosomal protein L9 C-domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 9.77e-16
Family Ribosomal protein L9 N-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_0738
Sequence length 191
Comment (Sinorhizobium medicae WSM419)
Sequence
MEVILLERIAKLGQMGETVKVRDGFARNYLLPLGKALRANASNKARFEAERSTLEARNLE
RKSEAQKVAESLDGKSFIIVRSAGETGQLYGSVAARDIVETLAAEGFNINRNQVDLNQPI
KAIGLHTVTLHLHGEVDVAIEINVARSAEEAERQAKGESLTSADAIYGVDEDALKPEDFF
NPEAEIESEEE
Download sequence
Identical sequences A6U7G4
WP_011974938.1.29075 WP_011974938.1.61285 WP_011974938.1.7720 WP_011974938.1.89664 YP_001326429.1.44884 366394.Smed_0738 gi|150395962|ref|YP_001326429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]