SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_1554 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  366394.Smed_1554
Domain Number - Region: 21-76
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00196
Family Anti-sigma factor antagonist SpoIIaa 0.034
Further Details:      
 
Domain Number - Region: 187-273
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0194
Family DmpA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_1554
Sequence length 379
Comment (Sinorhizobium medicae WSM419)
Sequence
MTPAQTETAADVVVDEGAAGNGRRYVFSGDWRHETAEAMSAKLKRLGKPAGGQSEFDFSG
ITAMDTAGAWIIRRFMNGTADEVRFAGSDRYAELILALPKQLRSPEGETARAPLFQRLFA
PVGELTVSIWTDTVAAMYILGSAVRGAQMKLGRHAGVSPAAIVHQIDRMGVMATPIITLM
SFLIGAIIAQQGAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGS
MKMREEVDALKVMGLSPIGVLVFPRLVALTIVLPLLTIIANFAALAGAAMVAWAYSGITI
PTFLARLQEAVDFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTSSVVKSI
FVVILIDGLFAIFYAAIDF
Download sequence
Identical sequences A6U9R6
gi|150396764|ref|YP_001327231.1| 366394.Smed_1554 WP_011975704.1.29075 WP_011975704.1.61285 WP_011975704.1.7720 WP_011975704.1.89664 YP_001327231.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]