SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_2705 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  366394.Smed_2705
Domain Number - Region: 94-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00144
Family NfeD domain-like 0.0099
Further Details:      
 
Domain Number - Region: 18-87
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00183
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_2705
Sequence length 151
Comment (Sinorhizobium medicae WSM419)
Sequence
MIERIVLELGPWSWWVLGLLLLAAELALPGVFLVWIALAALVTGALSLFFWEAPFWSWQL
QFVAFALLSVASVLIGRRFVSSSAESDEPLLNRRGESLVGRTAVLEQPIAEGRGRVRLDD
TTWAVEGPDLPVGTRVRIVASSGRHLTVEPV
Download sequence
Identical sequences A6UD05
WP_012066921.1.29075 WP_012066921.1.31871 WP_012066921.1.61285 WP_012066921.1.7720 WP_012066921.1.89664 YP_001328370.1.44884 gi|150397903|ref|YP_001328370.1| 366394.Smed_2705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]