SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_3678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_3678
Domain Number 1 Region: 40-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000549
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_3678
Sequence length 117
Comment (Sinorhizobium medicae WSM419)
Sequence
MGTEYMEIKEDEYRVWSEGNDIYFDGTMRLPSTEAYAPIFALVTSVLEAEPERMTVDLTG
LQFLNSSGINLLAKLTIEARKRPNIQFTVRGSSEFPWQSKSLPNLKKLHPGVDLRLG
Download sequence
Identical sequences A6UFR1
gi|150375828|ref|YP_001312424.1|NC_009620 WP_011969314.1.29075 WP_011969314.1.61285 WP_011969314.1.7720 YP_001312424.1.44884 366394.Smed_3678 gi|150375828|ref|YP_001312424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]