SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_4519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_4519
Domain Number 1 Region: 6-210
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.81e-24
Family Clp protease, ClpP subunit 0.065
Further Details:      
 
Domain Number 2 Region: 388-449
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000706
Family NfeD domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_4519
Sequence length 452
Comment (Sinorhizobium medicae WSM419)
Sequence
MARILFLLFSLLSAFMLPVSPAPAAERKAIVLHVNGAISPATAEYVTRGLRRARDRGVAL
VVLQMDTPGGLDTSMREIIRAILDSPVPVASFVAPSGARAASAGTYILYASHIAAMAPGT
NLGAATPIAIGGGLFGDDERDGEETPGEPDKQEPRKPADAGEAKLINDAIAYIRGLAELR
GRNIDWAERAVREAASLSSAAAAREQVIDFTAINLNDLLKQAHGRSVRIGQSDVRLDTAG
LFIEDLPPDWRTQLLSVITNPNVALLLMMVGIYGLIFEFLSPGTVVPGTIGGISLLLGLY
ALAVLPVSYAGVALILLGAGLLVAEAHAPSFGVLGLGSAVALVLGAAILFDTDVPGLQVS
WPVLSGIGFASLAFGLLVARLALLSSRHKILTGAEEMIGISGKVDSWEGAGGYVIAHGER
WSAVSNEPLGPGEDVMVVGRQSLTLEVARKPT
Download sequence
Identical sequences A6UI39
gi|150376656|ref|YP_001313252.1| YP_001313252.1.44884 gi|150376656|ref|YP_001313252.1|NC_009620 366394.Smed_4519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]