SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_0277 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366602.Caul_0277
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000171
Family Anti-sigma factor antagonist SpoIIaa 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_0277
Sequence length 95
Comment (Caulobacter K31)
Sequence
MSTAIALPETLDLKASGPLKQAFVERRGQDIEVHADQVRRLGGLCLQVLLAARKAWAEDG
KPFSITAPSEAFVETIRLFGAEGALFQTDIQGAAS
Download sequence
Identical sequences B0T4B4
gi|167644249|ref|YP_001681912.1| 366602.Caul_0277 WP_012284372.1.20905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]