SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_1128 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366602.Caul_1128
Domain Number 1 Region: 119-323
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.07e-49
Family D-glucarate dehydratase-like 0.0000372
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.37e-21
Family Enolase N-terminal domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_1128
Sequence length 344
Comment (Caulobacter K31)
Sequence
MRLTARVQAHALTEPFVIARQVYTEANVVVVELAAGGVVGRGEAAGVDYRGDTPPAMLVQ
LEGLAAELDAGLMLDRSVLAGRLPAGGARNAVDCALWDLEAQLTGVPVAARTGLAPLRAI
ETFVTLGMDTAAVVGAKAARWAGSFPALKVKLGDHQDIARLEAIRSAAPGCRLIADANQG
WTLAQLNDRAPHLAALGVELLEQPLPVGADDELLDYRGTVPLCADESFDERADLDRVVGR
YEFCNIKLDKCGGLTEALALMDAARSRGLRLMVGCMEGTSLGIAPALLVAQGCEVVDLDC
PIQLVADIAGGFGYRDAMLRPGSGLWGEAGRALLNPSRPRSPGA
Download sequence
Identical sequences B0SX97
WP_012285185.1.20905 gi|167645093|ref|YP_001682756.1| 366602.Caul_1128 NYSGXRC-9715a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]