SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_2544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366602.Caul_2544
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily Formyltransferase 6.28e-54
Family Formyltransferase 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_2544
Sequence length 193
Comment (Caulobacter K31)
Sequence
MTQRTKVAVLISGRGSNMEALVRAAQDPACPFEIALVLSNKPEAGGLITAAAAGIEALAV
DQKAYGKDREAHERAIDAALRERGIQVVALAGYMRILTPFLVETWAGRMLNIHPSLLPAY
PGLDTHGRALRAGEVEAGCTVHLVTAGVDEGPVLGQARVPILPGDTEHMLSDRVLEQEHQ
LYPATLAEFVRGL
Download sequence
Identical sequences B0SWP3
WP_012286574.1.20905 366602.Caul_2544 gi|167646506|ref|YP_001684169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]