SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_4363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  366602.Caul_4363
Domain Number - Region: 2-63
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.000144
Family GIY-YIG endonuclease 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_4363
Sequence length 91
Comment (Caulobacter K31)
Sequence
MYYVGSHRGEDPSTRAASHNQGADPKAFTYKRRPVVLVWSEHFDQIIDAVAWERRLKGWS
RAKKEAVIRGDWDVLPGLSRSRNPRPSTSSG
Download sequence
Identical sequences B0SZF4
366602.Caul_4363 gi|167648318|ref|YP_001685981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]