SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366602.Caul_4420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366602.Caul_4420
Domain Number 1 Region: 93-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000248
Family NfeD domain-like 0.0045
Further Details:      
 
Weak hits

Sequence:  366602.Caul_4420
Domain Number - Region: 19-81
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0288
Family Clc chloride channel 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366602.Caul_4420
Sequence length 151
Comment (Caulobacter K31)
Sequence
MNGLMLFYATHPFWVWLAVAAIFLAVEVATGTGWLLWPAASAAVVGLLTLVVAPGLAVEV
GLFAMLTIASTYLARRFLRPVLDGPPHIDLNDPTLRLIGRDCEVLETFQNGKGRVFADGK
EWAAVIREGQPPSAGQKVMVVAIDGAVLTVR
Download sequence
Identical sequences B0T050
WP_012288417.1.20905 366602.Caul_4420 gi|167648375|ref|YP_001686038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]