SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 368407.Memar_0501 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368407.Memar_0501
Domain Number 1 Region: 88-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000107
Family NfeD domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 368407.Memar_0501
Sequence length 152
Comment (Methanoculleus marisnigri JR1)
Sequence
MLAEGITLGWMLIVLGAVLLLVEVYQPGFFIAVPATVMIILGVLLLLGVDILSSPWGLVV
GVLAAIVAASVTVWLYGRLTPGQEPPTTLSRDSLVGLEGTVVVPVDPETLVGKVRLGSME
WSARSESGEIPVGRKVIVVRSEGVHVVVKEVV
Download sequence
Identical sequences A3CST4
WP_011843344.1.74427 gi|126178451|ref|YP_001046416.1| 368407.Memar_0501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]