SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 368407.Memar_1809 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368407.Memar_1809
Domain Number 1 Region: 130-394
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.03e-91
Family Enolase 0.00000401
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.05e-37
Family Enolase N-terminal domain-like 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 368407.Memar_1809
Sequence length 395
Comment (Methanoculleus marisnigri JR1)
Sequence
MTTIEQIILRTILDSRGNETVEAEIYTDCGFGRAAAPSGASTGTYEAKVRPPREAVEDAR
KNLIPSLIGEDTRDQITFDALLRENDGTPDFSSIGANVAVALSLACAKAAAASLDLELFR
YLGGTFAADTPLPLGNVIGGGAHAPNATSIQEFLVVPTGACGATEGVFVNAAVHKTVKKM
LQEQGKLSGKGDEGAWAPAVSDIEAFEIIGEAIDTVSDETNVEIRMGIDVAASELWNGEQ
YRYKDAKRSREDQVAYMADLVDRYNLIYIEDPLFEEDFEAFADLTEQVGDRCLICGDDLF
VTNVERIMKGTETGAANCVLIKPNQIGTLTDTFEAIRLAQENGMETVMSHRSGETTDATI
AHLATAFGCIFLKTGVVGGERIAKLNELIRIEELI
Download sequence
Identical sequences A3CWI5
368407.Memar_1809 WP_011844644.1.74427 gi|126179752|ref|YP_001047717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]