SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 368407.Memar_2320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368407.Memar_2320
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.59e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 368407.Memar_2320
Sequence length 175
Comment (Methanoculleus marisnigri JR1)
Sequence
MYEIRIHSRGGQGGVTAAKLLALAAFRDGKHATACPFYGAERRGAPVVSFVRIDDEPIKV
YSQIHEPDLVIVLDTSIMDVVDVLDGLKADGTVLLNSAHPVAGCNGTCRHVDLTGIALAQ
NLVVAGSPILNTPVLGALAKVGIVTLPSALQAIREMFADERNVKAAEAAYEELKV
Download sequence
Identical sequences A3CXZ3
368407.Memar_2320 WP_011845152.1.74427 gi|126180260|ref|YP_001048225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]