SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 368408.Tpen_0263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  368408.Tpen_0263
Domain Number 1 Region: 114-365
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.85e-58
Family D-glucarate dehydratase-like 0.00000361
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.2e-33
Family Enolase N-terminal domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 368408.Tpen_0263
Sequence length 370
Comment (Thermofilum pendens Hrk 5)
Sequence
MEIRKLELFYLEMKLKEEFRTSFGSVSTRPVVLVRVEEKGGEEGWGELVADRGPWYSYET
YETSSLVIRKFIAPSLVGRDIEEVEDFHRLVASIRGYPMAKTAVEEALLDLEARMEGRSV
SEVLGGSRQEIEAGVSIGIKASVEELLREVRRRLEEGYQRIKVKIKPGYDVEVVKRIREE
FGDIRLQVDANGAYSLRDIGVFRELDRFNLLMLEQPLAYDDLYEHSVLSRKISTPVCLDE
SIRSLHDLVVASILGSAEVVNVKPARVGGVLKAKSILEVAAKLGWGAWVGGMLETGIGRA
FLVALASLPFVNYPNDISASNRYWDEDIVEPPWEITPRGTIAVPRRRGLGVEVKRELVDR
LSLERWTATY
Download sequence
Identical sequences A1RWU3
368408.Tpen_0263 WP_011751938.1.94153 gi|119719181|ref|YP_919676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]